P Glycoprotein Polyclonal Antibody | anti-ABCB1 antibody

Anti-P Glycoprotein Antibody

Cat. Num. AAA178276

• Gene Names: ABCB1; CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: P Glycoprotein; Polyclonal Antibody; Anti-P Glycoprotein Antibody; Multidrug resistance protein 1; ABC20; ABCB1; ATP binding cassette; sub family B (MDR/TAP); member 1; ATP-binding cassette sub-family B member 1; CD243; CLCS; Colchicin sensitivity; Doxorubicin resistance; GP170; MDR1; MDR1_HUMAN; Multidrug resistance 1; P glycoprotein 1; P gp; P-glycoprotein 1; PGY1; ATP-binding cassette; sub-family B (MDR/TAP); anti-ABCB1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
• Sequence Length: 1280

• Applicable Applications for anti-ABCB1 antibody: Immunohistochemistry (IHC) Formalin/Paraffin
• Application Notes: Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml; Immunohistochemistry (IHC) Formalin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Immunohistochemistry (IHC)

(Anti-P Glycoprotein Picoband antibody, -1.JPGIHC(F): Mouse Intestine Tissue)

Immunohistochemistry (IHC)

(Anti-P Glycoprotein Picoband antibody, -2.JPGIHC(F): Rat Kidney Tissue)

Immunohistochemistry (IHC)

(Anti-P Glycoprotein Picoband antibody, -3.JPGIHC(P): Human Lung Cancer Tissue)

Immunohistochemistry (IHC)

(Anti-P Glycoprotein Picoband antibody, -4.JPGIHC(P): Mouse Kidney Tissue)

Immunohistochemistry (IHC)

(Anti-P Glycoprotein Picoband antibody, -5.JPGIHC(P): Rat Kidney Tissue)

Related Product Information for anti-ABCB1 antibody

Description: Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat.

Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the bloodbrain barrier.

References

1. Aller SG, Yu J, Ward A, Weng Y, Chittaboina S, Zhuo R, Harrell PM, Trinh YT, Zhang Q, Urbatsch IL, Chang G (March 2009). 2. Ueda K, Clark DP, Chen CJ, Roninson IB,Gottesman MM, Pastan I (January 1987). "The human multidrug resistance (mdr1) gene. cDNA cloning and transcription initiation". J. Biol. Chem.262 (2): 505-8.

NCBI and Uniprot Product Information

• NCBI GI #: 42741659
• NCBI GeneID: 5243
• NCBI Accession #: NP_000918.2
• NCBI GenBank Nucleotide #: NM_000927.4
• UniProt Accession #: P08183; Q12755; Q14812; A8K294; B5AK60
• Molecular Weight: 134,032 Da
• NCBI Official Full Name: multidrug resistance protein 1
• NCBI Official Synonym Full Names: ATP binding cassette subfamily B member 1
• NCBI Official Symbol: ABCB1
• NCBI Official Synonym Symbols: CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
• NCBI Protein Information: multidrug resistance protein 1
• UniProt Protein Name: Multidrug resistance protein 1
• Protein Family: ABC transporter B family
• UniProt Gene Name: ABCB1
• UniProt Synonym Gene Names: MDR1; PGY1
• UniProt Entry Name: MDR1_HUMAN

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCB1: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily. Interacts with PSMB8.

Protein type: EC 3.6.3.44; Membrane protein, integral; Transporter, ABC family; Hydrolase; Membrane protein, multi-pass; Transporter; Cell adhesion

Chromosomal Location of Human Ortholog: 7q21.12

Cellular Component: cell surface; integral to membrane; membrane; plasma membrane

Molecular Function: ATP binding; ATPase activity, coupled to transmembrane movement of substances; protein binding; transporter activity; xenobiotic-transporting ATPase activity

Biological Process: antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent; antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent; antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; G2/M transition of mitotic cell cycle; metabolic process; multidrug transport; positive regulation of antigen processing and presentation of peptide antigen via MHC class I; response to drug; transmembrane transport; transport; xenobiotic transport

Disease: Colchicine Resistance; Inflammatory Bowel Disease 13