Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti-APRIL Picoband antibody, MBS178209, Western blottingAll lanes: Anti APRIL (MBS178209) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugLane 5: RAJI Whole Cell Lysate at 40ugLane 6: U937 Whole Cell Lysate at 40ugPredicted bind size: 27KDObserved bind size: 27KD)

anti-Human APRIL Polyclonal Antibody | anti-APRIL antibody

Anti-APRIL Antibody

Gene Names
TNFSF13; APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715
Reactivity
Human
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
APRIL; Polyclonal Antibody; Anti-APRIL Antibody; Tumor necrosis factor ligand superfamily member 13; A proliferation inducing ligand; A proliferation-inducing ligand; CD 256; CD256; CD256 antigen; Ligand; PRO715; Proliferation inducing ligand APRIL; TALL 2; TALL-2; TALL2; TNF and APOL related leukocyte expressed ligand 2; TNF related death ligand 1; TNF related death ligand; TNF- and APOL-related leukocyte expressed ligand 2; TNF-related death ligand 1; TNF13_HUMAN; TNFSF 13; TNFSF13; TNFSF13 protein; TRDL 1; TRDL-1; TRDL1; Tumor necrosis factor (ligand) superfamily member 13; Tumor necrosis factor (ligand) superfamily; member 13; Tumor necrosis factor like protein ZTNF2; Tumor necrosis factor related death ligand; Tumor necrosis factor related death ligand 1; Tumor necrosis factor superfamily member 13; TWE PRIL; UNQ383; UNQ383/ PRO715; ZTNF 2; ZTNF2; tumor necrosis factor (ligand) superfamily; anti-APRIL antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
222
Applicable Applications for anti-APRIL antibody
Western Blot (WB), ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-APRIL Picoband antibody, MBS178209, Western blottingAll lanes: Anti APRIL (MBS178209) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugLane 5: RAJI Whole Cell Lysate at 40ugLane 6: U937 Whole Cell Lysate at 40ugPredicted bind size: 27KDObserved bind size: 27KD)

Western Blot (WB) (Anti-APRIL Picoband antibody, MBS178209, Western blottingAll lanes: Anti APRIL (MBS178209) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugLane 5: RAJI Whole Cell Lysate at 40ugLane 6: U937 Whole Cell Lysate at 40ugPredicted bind size: 27KDObserved bind size: 27KD)
Related Product Information for anti-APRIL antibody
Description: Rabbit IgG polyclonal antibody for Tumor necrosis factor ligand superfamily member 13 (TNFSF13) detection. Tested with WB, ELISA in Human.

Background: A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
References
1. "Entrez Gene: TNFSF13 tumor necrosis factor (ligand) superfamily, member 13". 2. Hahne M, Kataoka T, Schröter M, Hofmann K, Irmler M, Bodmer JL et al. (Sep 1998). "APRIL, a new ligand of the tumor necrosis factor family, stimulates tumor cell growth". The Journal of Experimental Medicine 188 (6): 1185-90.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,589 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 13 isoform zeta
NCBI Official Synonym Full Names
tumor necrosis factor superfamily member 13
NCBI Official Symbol
TNFSF13
NCBI Official Synonym Symbols
APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715
NCBI Protein Information
tumor necrosis factor ligand superfamily member 13
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 13
UniProt Gene Name
TNFSF13
UniProt Synonym Gene Names
APRIL; TALL2; ZTNF2; APRIL; TALL-2; TRDL-1
UniProt Entry Name
TNF13_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]

Uniprot Description

TNFSF13: Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. May be implicated in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes. Belongs to the tumor necrosis factor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: cytoplasm; cytosol; extracellular region; extracellular space; membrane; nucleoplasm

Molecular Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding

Biological Process: immune response; positive regulation of cell proliferation; positive regulation of isotype switching to IgA isotypes; regulation of mRNA stability; signal transduction; tumor necrosis factor-mediated signaling pathway

Research Articles on APRIL

Similar Products

Product Notes

The APRIL tnfsf13 (Catalog #AAA178209) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-APRIL Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APRIL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the APRIL tnfsf13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APRIL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.