Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- STAT6 Picoband antibody, MBS177998, Western blottingAll lanes: Anti STAT6 (MBS177998) at 0.5ug/mlWB: Rat Brain Tissue Lysate at 50ugPredicted bind size: 94KDObserved bind size: 94KD )

STAT6 Polyclonal Antibody | anti-STAT6 antibody

Anti-STAT6 Antibody

Gene Names
STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT
Reactivity
Rat
Predicted to work with: Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
STAT6; Polyclonal Antibody; Anti-STAT6 Antibody; Signal transducer and activator of transcription 6; D12S1644; IL 4 STAT; IL-4 Stat; IL4 STAT; Interleukin 4 Induced; Interleukin 4 Induced Transcription Factor IL4 STAT; Signal Transducer And Activator Of Transcription 6 Interleukin 4 Induced; Signal Transducer And Activator Of Transcription 6 Nirs Variant 1; interleukin 4 induced; STAT 6; STAT interleukin4 induced; STAT; interleukin4 induced; Stat6; STAT6_HUMAN; STAT6B; STAT6C; Transcription factor IL 4 STAT; signal transducer and activator of transcription 6; interleukin-4 induced; anti-STAT6 antibody
Ordering
For Research Use Only!
Reactivity
Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
847
Applicable Applications for anti-STAT6 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- STAT6 Picoband antibody, MBS177998, Western blottingAll lanes: Anti STAT6 (MBS177998) at 0.5ug/mlWB: Rat Brain Tissue Lysate at 50ugPredicted bind size: 94KDObserved bind size: 94KD )

Western Blot (WB) (Anti- STAT6 Picoband antibody, MBS177998, Western blottingAll lanes: Anti STAT6 (MBS177998) at 0.5ug/mlWB: Rat Brain Tissue Lysate at 50ugPredicted bind size: 94KDObserved bind size: 94KD )
Related Product Information for anti-STAT6 antibody
Description: Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 6(STAT6) detection. Tested with WB in Human;Rat.

Background: STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
References
1. Dickensheets, H. L., Venkataraman, C., Schindler, U., Donnelly, R. P.Interferons inhibit activation of STAT6 by interleukin 4 in human monocytes by inducing SOCS-1 gene expression.Proc. Nat. Acad. Sci. 96: 10800-10805, 1999. 2. Duetsch, G., Illig, T., Loesgen, S., Rohde, K., Kloop, N., Herbon, N., Cohlke, H., Altmueller, J., Wjst, M.STAT6 as an asthma candidate gene: polymorphism-screening, association and haplotype analysis in a Caucasian sib-pair study.Hum. Molec. Genet. 11: 613-621, 2002. 3. Mullings, R. E., Wilson, S. J., Puddicombe, S. M., Lordan, J. L., Bucchieri, F., Djukanovic, R., Howarth, P. H., Harper, S., Holgate, S. T., Davies, D. E.Signal transducer and activator of transcription 6 (STAT-6) expression and function in asthmatic bronchial epithelium.J. Allergy Clin. Immun. 108: 832-838, 2001.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81,748 Da
NCBI Official Full Name
signal transducer and activator of transcription 6 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 6
NCBI Official Symbol
STAT6
NCBI Official Synonym Symbols
STAT6B; STAT6C; D12S1644; IL-4-STAT
NCBI Protein Information
signal transducer and activator of transcription 6
UniProt Protein Name
Signal transducer and activator of transcription 6
UniProt Gene Name
STAT6
UniProt Entry Name
STAT6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

STAT6: transcription factor of the STAT family. Plays a central role in IL4-mediated biological responses. Induces the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. May function in the differentiation of T helper 2 cells and class switch of immunoglobulins. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cytoplasm; cytosol; lipid raft; nuclear chromatin; nucleoplasm

Molecular Function: identical protein binding; protein binding; protein phosphatase binding; signal transducer activity; transcription factor activity

Biological Process: mammary gland epithelial cell proliferation; negative regulation of T-helper 2 type immune response; negative regulation of transcription from RNA polymerase II promoter; positive regulation of interferon type I production; positive regulation of isotype switching to IgE isotypes; positive regulation of transcription from RNA polymerase II promoter; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; signal transduction; T-helper 1 cell lineage commitment; transcription, DNA-dependent

Research Articles on STAT6

Similar Products

Product Notes

The STAT6 stat6 (Catalog #AAA177998) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-STAT6 Antibody reacts with Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's STAT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the STAT6 stat6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.