GRP78 BiP Polyclonal Antibody | anti-GRP78 BiP antibody

Anti-GRP78 BiP Antibody

Cat. Num. AAA177791

• Gene Names: HSPA5; BIP; MIF2; GRP78; HEL-S-89n
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: GRP78 BiP; Polyclonal Antibody; Anti-GRP78 BiP Antibody; 78 kDa glucose-regulated protein; 78 kDa glucose regulated protein; AL022860; AU019543; BIP; D2Wsu141e; D2Wsu17e; Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; Endoplasmic reticulum lumenal Ca2+ binding protein grp78; FLJ26106; Glucose Regulated Protein 78kDa; GRP 78; GRP-78; GRP78; GRP78_HUMAN; Heat shock 70 kDa protein 5; Heat Shock 70kDa Protein 5; Hsce70; HSPA 5; HSPA5; Immunoglobulin Heavy Chain Binding Protein; Immunoglobulin heavy chain-binding protein; mBiP; MIF2; Sez7 antibody; heat shock 70kDa protein 5 (glucose-regulated protein; 78kDa); anti-GRP78 BiP antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 654

• Applicable Applications for anti-GRP78 BiP antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- GRP78 BiP Picoband antibody, MBS177791, Western blottingAll lanes: Anti GRP78 BiP (MBS177791) at 0.5ug/mlWB: HELA Whole Cell Lysate at 40ugPredicted bind size: 80KDObserved bind size: 80KD )

Immunohistochemistry (IHC)

(Anti- GRP78 BiP Picoband antibody, MBS177791, IHC(P)IHC(P): Mouse Testis Tissue )

Immunohistochemistry (IHC)

(Anti- GRP78 BiP Picoband antibody, MBS177791, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- GRP78 BiP Picoband antibody, MBS177791, IHC(P)IHC(P): Rat Testis Tissue )

Immunohistochemistry (IHC)

(Anti- GRP78 BiP Picoband antibody, MBS177791, IHC(P)IHC(P): Human Lung Cancer Tissue )

Related Product Information for anti-GRP78 BiP antibody

Description: Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

References

1. Hendershot, L. M., Valentine, V. A., Lee, A. S., Morris, S. W., Shapiro, D. N. Localization of the gene encoding human BiP/GRP78, the endoplasmic reticulum cognate of the HSP70 family, to chromosome 9q34. Genomics 20: 281-284, 1994. 2. Law, M. L., Seeliger, M. B., Lee, A. S., Kao, F. T. Genetic mapping of the structural gene coding for a glucose-regulated protein (GRP78) of 78k-dalton to the long arm of human chromosome 9. (Abstract) Cytogenet. Cell Genet. 37: 518-519, 1984. 3. Shen, J., Chen, X., Hendershot, L., Prywes, R. ER stress regulation of ATF6 localization by dissociation of BiP/GRP78 binding and unmasking of Golgi localization signals. Dev. Cell 3: 99-111, 2002.

NCBI and Uniprot Product Information

• NCBI GI #: 16507237
• NCBI GeneID: 3309
• NCBI Accession #: NP_005338.1
• NCBI GenBank Nucleotide #: NM_005347.4
• UniProt Accession #: P11021; Q2EF78; Q9NPF1; Q9UK02; B0QZ61
• Molecular Weight: 72,333 Da
• NCBI Official Full Name: 78 kDa glucose-regulated protein
• NCBI Official Synonym Full Names: heat shock protein family A (Hsp70) member 5
• NCBI Official Symbol: HSPA5
• NCBI Official Synonym Symbols: BIP; MIF2; GRP78; HEL-S-89n
• NCBI Protein Information: 78 kDa glucose-regulated protein
• UniProt Protein Name: 78 kDa glucose-regulated protein
• UniProt Gene Name: HSPA5
• UniProt Synonym Gene Names: GRP78; GRP-78; BiP
• UniProt Entry Name: GRP78_HUMAN

NCBI Description

The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER. As this protein interacts with many ER proteins, it may play a key role in monitoring protein transport through the cell.[provided by RefSeq, Sep 2010]

Uniprot Description

GRP78: a member of the HSP family of molecular chaperones required for endoplasmic reticulum integrity and stress-induced autophagy. Plays a central role in regulating the unfolded protein response (UPR), and is an obligatory component of autophagy in mammalian cells. May play an important role in cellular adaptation and oncogenic survival. One of the client proteins of GRP78 is protein double-stranded RNA-activated protein-like endoplasmic reticulum kinase (PERK). Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: cell surface; endoplasmic reticulum; endoplasmic reticulum lumen; endoplasmic reticulum membrane; ER-Golgi intermediate compartment; focal adhesion; integral to endoplasmic reticulum membrane; melanosome; membrane; midbody; mitochondrion; myelin sheath; nucleus; plasma membrane; signalosome; smooth endoplasmic reticulum

Molecular Function: ATP binding; ATPase activity; calcium ion binding; chaperone binding; enzyme binding; glycoprotein binding; misfolded protein binding; protein binding; protein domain specific binding; ribosome binding; ubiquitin protein ligase binding; unfolded protein binding

Biological Process: cellular response to glucose starvation; cerebellar Purkinje cell layer development; cerebellum structural organization; ER overload response; ER-associated protein catabolic process; negative regulation of apoptosis; negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of cell migration; positive regulation of protein ubiquitination; substantia nigra development; unfolded protein response; unfolded protein response, activation of signaling protein activity