SLC12A1 Polyclonal Antibody | anti-SLC12A1 antibody

Anti-SLC12A1 Antibody

Cat. Num. AAA177687

• Gene Names: SLC12A1; BSC1; NKCC2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: SLC12A1; Polyclonal Antibody; Anti-SLC12A1 Antibody; Solute carrier family 12 member 1; BSC1; Bumetanide sensitive sodium 3; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney specific Na K Cl symporter; Kidney-specific Na-K-Cl symporter; MGC48843; Na K 2Cl cotransporter; NKCC2; potassiumchloride cotransporter 2; S12A1_HUMAN; Slc12a1; sodium potassium chloride cotransporter 2; solute carrier family 12 (sodium/potassium/chloride transporters); Solute carrier family 12 member 1 antibody; member 1; anti-SLC12A1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1099

• Applicable Applications for anti-SLC12A1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SLC12A1 Picoband antibody, MBS177687, Western blottingAll lanes: Anti SLC12A1 (MBS177687) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: SKOV Whole Cell Lysate at 40ugLane 4: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 121KDObserved bind size: 121KD )

Immunohistochemistry (IHC)

(Anti- SLC12A1 Picoband antibody, MBS177687, IHC(P)IHC(P): Mouse Kidney Tissue )

Immunohistochemistry (IHC)

(Anti- SLC12A1 Picoband antibody, MBS177687, IHC(P)IHC(P): Rat Kidney Tissue )

Immunohistochemistry (IHC)

(Anti- SLC12A1 Picoband antibody, MBS177687, IHC(P)IHC(P): Human Kidney Cancer Tissue )

Related Product Information for anti-SLC12A1 antibody

Description: Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.

References

1. Nozu, K., Iijima, K., Kawai, K., Nozu, Y., Nishida, A., Takeshima, Y., Fu, X. J., Hashimura, Y., Kaito, H., Nakanishi, K., Yoshikawa, N., Matsuo, M. In vivo and in vitro splicing assay of SLC12A1 in an antenatal salt-losing tubulopathy patient with an intronic mutation. Hum. Genet. 126: 533-538, 2009. 2. Takahashi, N., Chernavvsky, D. R., Gomez, R. A., Igarashi, P., Gitelman, H. J., Smithies, O.Uncompensated polyuria in a mouse model of Bartter's syndrome. Proc. Nat. Acad. Sci. 97: 5434-5439, 2000.

NCBI and Uniprot Product Information

• NCBI GI #: 134254459
• NCBI GeneID: 6557
• NCBI Accession #: NP_000329.2
• NCBI GenBank Nucleotide #: NM_000338.2
• UniProt Accession #: Q13621; A8JYA2; E9PDW4
• Molecular Weight: – Da
• NCBI Official Full Name: solute carrier family 12 member 1 isoform A
• NCBI Official Synonym Full Names: solute carrier family 12 member 1
• NCBI Official Symbol: SLC12A1
• NCBI Official Synonym Symbols: BSC1; NKCC2
• NCBI Protein Information: solute carrier family 12 member 1
• UniProt Protein Name: Solute carrier family 12 member 1
• Protein Family: Solute carrier family
• UniProt Gene Name: SLC12A1
• UniProt Synonym Gene Names: NKCC2
• UniProt Entry Name: S12A1_HUMAN

NCBI Description

This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their biological validity in humans has not been experimentally proven.[provided by RefSeq, May 2010]

Uniprot Description

NKCC2: Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume. Kidney specific. Activated by WNK3. Belongs to the SLC12A transporter family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 15q15-q21.1

Cellular Component: apical plasma membrane; cell surface; integral to membrane; membrane; plasma membrane

Molecular Function: sodium:potassium:chloride symporter activity

Biological Process: diterpenoid metabolic process; ion transport; potassium ion transport; protein insertion into membrane from inner side; sodium ion transport; transport

Disease: Bartter Syndrome, Antenatal, Type 1