SAPK4 Polyclonal Antibody | anti-SAPK4 antibody

Anti-SAPK4 Antibody

Cat. Num. AAA177654

• Gene Names: MAPK13; SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: SAPK4; Polyclonal Antibody; Anti-SAPK4 Antibody; Mitogen-activated protein kinase 13; MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; Mapk13; MGC99536; Mitogen activated protein kinase 13; Mitogen-activated protein kinase p38 delta; MK13_HUMAN; OTTHUMP00000016282; OTTHUMP00000016283; p38 delta; P38delta; PRKM13; SAPK 4; Stress activated protein kinase 4; Stress-activated protein kinase 4 antibody; mitogen-activated protein kinase 13; anti-SAPK4 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 365

• Applicable Applications for anti-SAPK4 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4 (332-365aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- SAPK4 Picoband antibody, MBS177654, Western blottingAll lanes: Anti SAPK4 (MBS177654) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 42KDObserved bind size: 42KD)

Immunohistochemistry (IHC)

(Anti- SAPK4 Picoband antibody, MBS177654,IHC(P)IHC(P): Mouse Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- SAPK4 Picoband antibody, MBS177654,IHC(P)IHC(P): Rat Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- SAPK4 Picoband antibody, MBS177654,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-SAPK4 antibody

Description: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 13(MAPK13) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4(SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

References

1. Goedert, M., Cuenda, A., Craxton, M., Jakes, R., Cohen, P. Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases. EMBO J. 16: 3563-3571, 1997. 2. Kumar, S., McDonnell, P. C., Gum, R. J., Hand, A. T., Lee, J. C., Young, P. R. Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles. Biochem. Biophys. Res. Commun. 235: 533-538, 1997. 3. Wang, X. S., Diener, K., Manthey, C. L., Wang, S., Rosenzweig, B., Bray, J., Delaney, J., Cole, C. N., Chan-Hui, P.-Y., Mantlo, N., Lichenstein, H. S., Zukowski, M., Yao, Z. Molecular cloning and characterization of a novel p38 mitogen-activated protein kinase. J. Biol. Chem. 272: 23668-23674, 1997.

NCBI and Uniprot Product Information

• NCBI GI #: 4506085
• NCBI GeneID: 5603
• NCBI Accession #: NP_002745.1
• NCBI GenBank Nucleotide #: NM_002754.4
• UniProt Accession #: O15264; O14739; O15124; Q5U4A5; Q6FI46; Q9UNU0
• Molecular Weight: 28,779 Da
• NCBI Official Full Name: mitogen-activated protein kinase 13
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 13
• NCBI Official Symbol: MAPK13
• NCBI Official Synonym Symbols: SAPK4; PRKM13; MAPK 13; MAPK-13; p38delta
• NCBI Protein Information: mitogen-activated protein kinase 13
• UniProt Protein Name: Mitogen-activated protein kinase 13
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: MAPK13
• UniProt Synonym Gene Names: PRKM13; SAPK4; MAP kinase 13; MAPK 13; MAP kinase p38 delta
• UniProt Entry Name: MK13_HUMAN

NCBI Description

This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

P38D: a proline-directed ser/thr MAP kinase, and one of four p38 kinases that play important roles in cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have a few hundred substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of tau and STH. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator Myb in response to stress which leads to rapid Myb degradation via a proteasome-dependent pathway. Phosphorylates and down-regulates PKD1 during regulation of insulin secretion in pancreatic beta cells. Expressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells. This description may include information from UniProtKB

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.24; CMGC group; MAPK family; p38 subfamily; MAPK/p38 subfamily

Chromosomal Location of Human Ortholog: 6p21.31

Cellular Component: cytosol

Molecular Function: ATP binding; MAP kinase activity; protein binding; protein serine/threonine kinase activity

Biological Process: cell cycle; MAPKKK cascade; peptidyl-serine phosphorylation; positive regulation of inflammatory response; positive regulation of interleukin-6 production; regulation of transcription, DNA-dependent; response to osmotic stress; response to stress; transcription, DNA-dependent; vascular endothelial growth factor receptor signaling pathway