Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ALDH2 Monoclonal Antibody | anti-ALDH2 antibody

Anti-ALDH2 Antibody (Monoclonal, 6H2)

Gene Names
ALDH2; ALDM; ALDHI; ALDH-E2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
ALDH2; Monoclonal Antibody; Anti-ALDH2 Antibody (Monoclonal; 6H2); Aldehyde dehydrogenase; mitochondrial (EC:1.2.1.3); AHD-M1; ALDH class 2; ALDH-E2; ALDHI; anti-ALDH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1
Clone Number
6H2
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
517
Applicable Applications for anti-ALDH2 antibody
Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5ug/ml (Human, Mouse, Rat)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-ALDH2 antibody
Description: Mouse IgG monoclonal antibody for ALDH2 detection. Tested with WB, ICC/IF, FCM in Human; Mouse; Rat.

Background: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
References
1. Chen, C.-H., Budas, G. R., Churchill, E. N., Disatnik, M.-H., Hurley, T. D., Mochly-Rosen, D. Activation of aldehyde dehydrogenase-2 reduces ischemic damage to the heart. Science 321: 1493-1495, 2008.
2. Goedde, H. W., Agarwal, D. P., Fritze, G., Meier-Tackmann, D., Singh, S., Beckmann, G., Bhatia, K., Chen, L. Z., Fang, B., Lisker, R., Paik, Y. K., Rothhammer, F., Saha, N., Segal, B., Srivastava, L. M., Czeizel, A. Distribution of ADH-2 and ALDH2 genotypes in different populations. Hum. Genet. 88: 344-346, 1992.
3. Hsu, L. C., Yoshida, A., Mohandas, T. Chromosomal assignment of the genes for human aldehyde dehydrogenase 1 (ALDH1) and aldehyde dehydrogenase 2 (ALDH2). (Abstract) Cytogenet. Cell Genet. 40: 656-657, 1985.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
217
UniProt Accession #
NCBI Official Full Name
Aldehyde dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
aldehyde dehydrogenase 2 family member
NCBI Official Symbol
ALDH2
NCBI Official Synonym Symbols
ALDM; ALDHI; ALDH-E2
NCBI Protein Information
aldehyde dehydrogenase, mitochondrial
UniProt Protein Name
Aldehyde dehydrogenase, mitochondrial
UniProt Gene Name
ALDH2
UniProt Synonym Gene Names
ALDM
UniProt Entry Name
ALDH2_HUMAN

NCBI Description

This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Nov 2016]

Uniprot Description

ALDH2: This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2011]

Protein type: Lipid Metabolism - glycerolipid; Lipid Metabolism - fatty acid; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 1.2.1.3; Amino Acid Metabolism - histidine; Carbohydrate Metabolism - ascorbate and aldarate; Mitochondrial; Carbohydrate Metabolism - propanoate; Oxidoreductase; Amino Acid Metabolism - arginine and proline; Carbohydrate Metabolism - pyruvate; Amino Acid Metabolism - tryptophan; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Other Amino Acids Metabolism - beta-alanine; Amino Acid Metabolism - lysine degradation; Carbohydrate Metabolism - butanoate

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrial matrix

Molecular Function: aldehyde dehydrogenase (NAD) activity; electron carrier activity; aldehyde dehydrogenase [NAD(P)+] activity

Biological Process: synaptic transmission; ethanol catabolic process; xenobiotic metabolic process; alcohol metabolic process; carbohydrate metabolic process; ethanol oxidation; neurotransmitter biosynthetic process

Disease: Alcohol Sensitivity, Acute

Research Articles on ALDH2

Similar Products

Product Notes

The ALDH2 aldh2 (Catalog #AAA1753202) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-ALDH2 Antibody (Monoclonal, 6H2) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS). WB: 0.1-0.5ug/ml (Human, Mouse, Rat) ICC: 2ug/ml (Human) IF: 2ug/ml (Human) FC/FACS: 1-3ug/1x106 cells (Human) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the ALDH2 aldh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.