Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit TMEM166/EVA1A Polyclonal Antibody | anti-TMEM166 antibody

Anti-TMEM166/EVA1A Antibody

Gene Names
EVA1A; FAM176A; TMEM166
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
TMEM166/EVA1A; Polyclonal Antibody; Anti-TMEM166/EVA1A Antibody; Protein eva-1 homolog A; Protein FAM176A; Transmembrane protein 166; EVA1A; FAM176A; TMEM166; SP24; Eva-1 homolog A; regulator of programmed cell death; anti-TMEM166 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
152
Applicable Applications for anti-TMEM166 antibody
Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
IHC-F: 0.5-1 mug/ml
ICC: 0.5-1 mug/ml
FC/FACS: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Immunogen
A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P, IHC-F and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Related Product Information for anti-TMEM166 antibody
Description: Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.
Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
References
1. Sun W, Ma XM, Bai JP, Zhang GQ, Zhu YJ, Ma HM, Guo H, Chen YY, Ding JB (2012). "Transmembrane protein 166 expression in esophageal squamous cell carcinoma in Xinjiang, China". Asian Pacific Journal of Cancer Prevention. 13 (8): 3713-6. 2. Wang L, Yu C, Lu Y, He P, Guo J, Zhang C, Song Q, Ma D, Shi T, Chen Y (August 2007). "TMEM166, a novel transmembrane protein, regulates cell autophagy and apoptosis". Apoptosis. 12 (8): 1489-502.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,470 Da
NCBI Official Full Name
protein eva-1 homolog A
NCBI Official Synonym Full Names
eva-1 homolog A, regulator of programmed cell death
NCBI Official Symbol
EVA1A
NCBI Official Synonym Symbols
FAM176A; TMEM166
NCBI Protein Information
protein eva-1 homolog A
UniProt Protein Name
Protein eva-1 homolog A
UniProt Gene Name
EVA1A
UniProt Synonym Gene Names
FAM176A; TMEM166

Uniprot Description

Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Research Articles on TMEM166

Similar Products

Product Notes

The TMEM166 eva1a (Catalog #AAA1751521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TMEM166/EVA1A Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM166/EVA1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS). WB: 0.1-0.5 mug/ml IHC-P: 0.5-1 mug/ml IHC-F: 0.5-1 mug/ml ICC: 0.5-1 mug/ml FC/FACS: 1-3ug/1x106 cells Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Researchers should empirically determine the suitability of the TMEM166 eva1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM166/EVA1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.