Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of Thrombopoietin using anti-Thrombopoietin antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HepG2 whole cell lysate,Lane 2: human Caco-2 whole cell lysate,Lane 3: rat liver tissue lysate,Lane 4: mouse liver tissue lysate, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Thrombopoietin antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Thrombopoietin at approximately 38KD. The expected band size for Thrombopoietin is at 38KD.)

Rabbit Thrombopoietin/THPO Polyclonal Antibody | anti-THPO antibody

Anti-Thrombopoietin/THPO Antibody

Gene Names
THPO; ML; TPO; MGDF; MKCSF; MPLLG; THCYT1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
Thrombopoietin/THPO; Polyclonal Antibody; Anti-Thrombopoietin/THPO Antibody; Thrombopoietin; C-mpl ligand; ML; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGDF; Myeloproliferative leukemia virus oncogene ligand; THPO; anti-THPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
349
Applicable Applications for anti-THPO antibody
Western Blot (WB), ELISA Capture (EIA)
Application Notes
WB: 0.1-0.5 mug/ml
ELISA (Cap):1-5 mug/ml
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human Thrombopoietin/THPO (DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of Thrombopoietin using anti-Thrombopoietin antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HepG2 whole cell lysate,Lane 2: human Caco-2 whole cell lysate,Lane 3: rat liver tissue lysate,Lane 4: mouse liver tissue lysate, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Thrombopoietin antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Thrombopoietin at approximately 38KD. The expected band size for Thrombopoietin is at 38KD.)

Western Blot (WB) (Figure 1. Western blot analysis of Thrombopoietin using anti-Thrombopoietin antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human HepG2 whole cell lysate,Lane 2: human Caco-2 whole cell lysate,Lane 3: rat liver tissue lysate,Lane 4: mouse liver tissue lysate, After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Thrombopoietin antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Thrombopoietin at approximately 38KD. The expected band size for Thrombopoietin is at 38KD.)
Related Product Information for anti-THPO antibody
Description: Rabbit IgG polyclonal antibody for Thrombopoietin/THPO detection. Tested with WB, ELISA (Cap) in Human; Mouse; Rat.
Background: Thrombopoietin  (THPO), also known as megakaryocyte growth and development factor  (MGDF), is a protein that in humans is encoded by the THPO gene. Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent.
References
1. "Entrez Gene: THPO thrombopoietin (myeloproliferative leukemia virus oncogene ligand, megakaryocyte growth and development factor)". 2. Kaushansky K (2006). "Lineage-specific hematopoietic growth factors". N. Engl. J. Med. 354  (19): 2034-45.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,387 Da
NCBI Official Full Name
thrombopoietin isoform 1
NCBI Official Synonym Full Names
thrombopoietin
NCBI Official Symbol
THPO
NCBI Official Synonym Symbols
ML; TPO; MGDF; MKCSF; MPLLG; THCYT1
NCBI Protein Information
thrombopoietin
UniProt Protein Name
Thrombopoietin
Protein Family
UniProt Gene Name
THPO
UniProt Synonym Gene Names
MGDF; ML; MGDF

NCBI Description

Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014]

Uniprot Description

Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.

Research Articles on THPO

Similar Products

Product Notes

The THPO thpo (Catalog #AAA1751450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Thrombopoietin/THPO Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Thrombopoietin/THPO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA Capture (EIA). WB: 0.1-0.5 mug/ml ELISA (Cap):1-5 mug/ml Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the THPO thpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Thrombopoietin/THPO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.