Rabbit anti-Human CHRNA3 Polyclonal Antibody | anti-CHRNA3 antibody

Anti-Human CHRNA3 DyLight 488 conjugated Antibody

Cat. Num. AAA1751400

• Gene Names: CHRNA3; LNCR2; PAOD2; NACHRA3
• Reactivity: Human
• Applications: Flow Cytometry, Functional Assay
• Purity: Immunogen Affinity Purified
• Synonyms: CHRNA3; Polyclonal Antibody; Anti-Human CHRNA3 DyLight 488 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human CHRNA3 Antibody DyLight 488 Conjugated; Flow Validated; Neuronal acetylcholine receptor subunit alpha-3; NACHRA3; Cholinergic receptor nicotinic alpha 3 subunit; anti-CHRNA3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Liquid
• Sequence Length: 504

• Applicable Applications for anti-CHRNA3 antibody: Flow Cytometry (FC/FACS)
• Application Notes: FC/FACS: 1-3ug/1x106 cells
• Immunogen: A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
• Preparation and Storage: Store at 2-8 degree C for one year. Protect from light. Do not freeze.

Related Product Information for anti-CHRNA3 antibody

Neuronal acetylcholine receptor subunit alpha-3, also known as nAChRalpha3, is a protein that in humans is encoded by the CHRNA3 gene. This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described.

References

1. "Entrez Gene: CHRNA3 cholinergic receptor, nicotinic, alpha 3". 2. Eng CM, Kozak CA, Beaudet AL, Zoghbi HY (Apr 1991). "Mapping of multiple subunits of the neuronal nicotinic acetylcholine receptor to chromosome 15 in man and chromosome 9 in mouse". Genomics. 9 (2): 278-82. 3. Mihovilovic M, Roses AD (1991). "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor.". Exp. Neurol. 111 (2): 175-80.

NCBI and Uniprot Product Information

• NCBI GI #: 19923122
• NCBI GeneID: 1136
• NCBI Accession #: NP_000734.2
• NCBI GenBank Nucleotide #: NM_000743.5
• UniProt Accession #: P32297; Q15823; Q4KMN8; Q86U77; Q96RH3; Q99553; Q9BQ93; Q9BRR4
• Molecular Weight: 57,423 Da
• NCBI Official Full Name: neuronal acetylcholine receptor subunit alpha-3 isoform 1
• NCBI Official Synonym Full Names: cholinergic receptor nicotinic alpha 3 subunit
• NCBI Official Symbol: CHRNA3
• NCBI Official Synonym Symbols: LNCR2; PAOD2; NACHRA3
• NCBI Protein Information: neuronal acetylcholine receptor subunit alpha-3
• UniProt Protein Name: Neuronal acetylcholine receptor subunit alpha-3
• Protein Family: Neuronal acetylcholine receptor
• UniProt Gene Name: CHRNA3
• UniProt Synonym Gene Names: NACHRA3

NCBI Description

This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009]

Uniprot Description

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.