Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Figure 1. Flow Cytometry analysis of A431 cells using anti-Human SUR1 antibody. Overlay histogram showing A431 cells stained with A00895-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human SUR1 Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )

Rabbit anti-Human SUR1 Polyclonal Antibody | anti-SUR1 antibody

Anti-Human SUR1 DyLight 488 conjugated Antibody

Gene Names
ABCC8; HI; SUR; HHF1; MRP8; PHHI; SUR1; ABC36; HRINS; TNDM2; SUR1delta2
Reactivity
Human
Applications
Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
SUR1; Polyclonal Antibody; Anti-Human SUR1 DyLight 488 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human SUR1 Antibody DyLight 488 Conjugated; Flow Validated; ATP binding cassette subfamily C member 8; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; ABCC8; HRINS; SUR; anti-SUR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Liquid
Sequence Length
1,582
Applicable Applications for anti-SUR1 antibody
Flow Cytometry (FC/FACS)
Application Notes
FC/FACS: 1-3ug/1x106 cells
Immunogen
A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA).
Conjugate
DyLight 488
Excitation Wavelength: 488 nm
Emission Wavelength: 515-545 nm
Contents
Each vial contains 50% glycerol, 0.9% NaCI, 0.2% Na2HPO4, 0.02% NaN3
Preparation and Storage
Store at 2-8°C. Protect from light. Do not freeze.

Flow Cytometry (FC/FACS)

(Figure 1. Flow Cytometry analysis of A431 cells using anti-Human SUR1 antibody. Overlay histogram showing A431 cells stained with A00895-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human SUR1 Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )

Flow Cytometry (FC/FACS) (Figure 1. Flow Cytometry analysis of A431 cells using anti-Human SUR1 antibody. Overlay histogram showing A431 cells stained with A00895-Dyl488 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Human SUR1 Antibody for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-rabbit IgG (5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control. )
Related Product Information for anti-SUR1 antibody
ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.
References
1. "Entrez Gene: ABCC8 ATP-binding cassette, sub-family C (CFTR/MRP), member 8". 2. Glaser B, Chiu KC, Anker R, Nestorowicz A, Landau H, Ben-Bassat H, Shlomai Z, Kaiser N, Thornton PS, Stanley CA, et al. (Nov 1994). "Familial hyperinsulinism maps to chromosome 11p14-15.1, 30 cM centromeric to the insulin gene". Nat Genet. 7 (2): 185-8. 3. Thomas PM, Cote GJ, Wohllk N, Haddad B, Mathew PM, Rabl W, Aguilar-Bryan L, Gagel RF, Bryan J (May 1995). "Mutations in the sulfonylurea receptor gene in familial persistent hyperinsulinemic hypoglycemia of infancy". Science. 268 (5209): 426-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-binding cassette sub-family C member 8 isoform 2
NCBI Official Synonym Full Names
ATP binding cassette subfamily C member 8
NCBI Official Symbol
ABCC8
NCBI Official Synonym Symbols
HI; SUR; HHF1; MRP8; PHHI; SUR1; ABC36; HRINS; TNDM2; SUR1delta2
NCBI Protein Information
ATP-binding cassette sub-family C member 8
UniProt Protein Name
ATP-binding cassette sub-family C member 8
UniProt Gene Name
ABCC8
UniProt Synonym Gene Names
HRINS; SUR; SUR1

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]

Uniprot Description

Subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release.

Research Articles on SUR1

Similar Products

Product Notes

The SUR1 abcc8 (Catalog #AAA1751284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Human SUR1 DyLight 488 conjugated Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUR1 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS). FC/FACS: 1-3ug/1x106 cells. Researchers should empirically determine the suitability of the SUR1 abcc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.