Probable ubiquitin-conjugating enzyme E2 variant (ube2v) Recombinant Protein | ube2v recombinant protein
Recombinant Dictyostelium discoideum Probable ubiquitin-conjugating enzyme E2 variant (ube2v)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ubiquitin-conjugating enzyme E2 variant (ube2v); Recombinant Dictyostelium discoideum Probable ubiquitin-conjugating enzyme E2 variant (ube2v); ube2v recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-138, Full length protein
Sequence
MTTIPRNFVLLEELESGEKSTGDGTISYGLESPDDILLSSWIGTIIGPQNTPFDNRFYSLKLYCDKDYPNKPPTVRFTTKINIGCVNQQNGVVDPKNLPILSNWTSKNRIQNILSELRREMSSSSNKKLVQPPEGANF
Sequence Length
138
Species
Dictyostelium discoideum (Slime mold)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,495 Da
NCBI Official Full Name
hypothetical protein DDB_G0292596
NCBI Official Symbol
ube2v
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Probable ubiquitin-conjugating enzyme E2 variant
Protein Family
UniProt Gene Name
ube2v
Uniprot Description
Has no ubiquitin ligase activity on its own. The ube2v/ube2n heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage ().
Similar Products
Product Notes
The ube2v ube2v (Catalog #AAA1482312) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-138, Full length protein. The amino acid sequence is listed below: MTTIPRNFVL LEELESGEKS TGDGTISYGL ESPDDILLSS WIGTIIGPQN TPFDNRFYSL KLYCDKDYPN KPPTVRFTTK INIGCVNQQN GVVDPKNLPI LSNWTSKNRI QNILSELRRE MSSSSNKKLV QPPEGANF. It is sometimes possible for the material contained within the vial of "Probable ubiquitin-conjugating enzyme E2 variant (ube2v), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
