Basic leucine zipper transcriptional factor ATF-like 3 (BATF3) Recombinant Protein | BATF3 recombinant protein

Recombinant Human Basic leucine zipper transcriptional factor ATF-like 3 (BATF3)

Cat. Num. AAA1481896

• Gene Names: BATF3; JDP1; SNFT; JUNDM1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Basic leucine zipper transcriptional factor ATF-like 3 (BATF3); Recombinant Human Basic leucine zipper transcriptional factor ATF-like 3 (BATF3); BATF3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-127, Full length protein
• Sequence: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
• Sequence Length: 127

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 8924246
• NCBI GeneID: 55509
• NCBI Accession #: NP_061134.1
• NCBI GenBank Nucleotide #: NM_018664.2
• UniProt Accession #: Q9NR55
• Molecular Weight: 14,468 Da
• NCBI Official Full Name: basic leucine zipper transcriptional factor ATF-like 3
• NCBI Official Synonym Full Names: basic leucine zipper ATF-like transcription factor 3
• NCBI Official Symbol: BATF3
• NCBI Official Synonym Symbols: JDP1; SNFT; JUNDM1
• NCBI Protein Information: basic leucine zipper transcriptional factor ATF-like 3
• UniProt Protein Name: Basic leucine zipper transcriptional factor ATF-like 3
• Protein Family: Basic leucine zipper transcriptional factor
• UniProt Gene Name: BATF3
• UniProt Synonym Gene Names: SNFT; B-ATF-3

NCBI Description

This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.[provided by RefSeq, Feb 2009]

Uniprot Description

AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (). Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes.