Probable global transcription activator SNF2L2 (Smarca2) Recombinant Protein | Smarca2 recombinant protein

Recombinant Mouse Probable global transcription activator SNF2L2 (Smarca2) , partial

Cat. Num. AAA1479142

• Gene Names: Smarca2; brm; Snf2l2; brahma; SNF2alpha; 2610209L14Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable global transcription activator SNF2L2 (Smarca2); Recombinant Mouse Probable global transcription activator SNF2L2 (Smarca2); partial; Smarca2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 741-906,Partial, provide the Helicase ATP-binding domain.
• Sequence: VSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPT
• Sequence Length: 906

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Smarca2 recombinant protein

This protein is a member of the SWI
SNF family of proteins and is highly similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF
SWI, which is required for transcriptional activation of genes normally repressed by chromatin. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

NCBI and Uniprot Product Information

• NCBI GI #: 1105531487
• NCBI GeneID: 67155
• NCBI Accession #: NP_001334368.1
• NCBI GenBank Nucleotide #: NM_001347439.1
• UniProt Accession #: Q6DIC0
• Molecular Weight: 180,253 Da
• NCBI Official Full Name: probable global transcription activator SNF2L2 isoform 3
• NCBI Official Synonym Full Names: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
• NCBI Official Symbol: Smarca2
• NCBI Official Synonym Symbols: brm; Snf2l2; brahma; SNF2alpha; 2610209L14Rik
• NCBI Protein Information: probable global transcription activator SNF2L2
• UniProt Protein Name: Probable global transcription activator SNF2L2
• Protein Family: Probable global transcription activator
• UniProt Gene Name: Smarca2
• UniProt Synonym Gene Names: BAF190B

Uniprot Description

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically (PubMed:22952240, PubMed:26601204). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.