AN1-type zinc finger protein 6 (Zfand6) Recombinant Protein | Zfand6 recombinant protein
Recombinant Mouse AN1-type zinc finger protein 6 (Zfand6)
Gene Names
Zfand6; Awp1; Za20d3; 3110005P07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
AN1-type zinc finger protein 6 (Zfand6); Recombinant Mouse AN1-type zinc finger protein 6 (Zfand6); Zfand6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-223, full length protein
Sequence
MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPAASVSSLSESLPVQCADGSVPDAQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSVDKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
Sequence Length
223
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,001 Da
NCBI Official Full Name
AN1-type zinc finger protein 6 isoform a
NCBI Official Synonym Full Names
zinc finger, AN1-type domain 6
NCBI Official Symbol
Zfand6
NCBI Official Synonym Symbols
Awp1; Za20d3; 3110005P07Rik
NCBI Protein Information
AN1-type zinc finger protein 6
UniProt Protein Name
AN1-type zinc finger protein 6
Protein Family
UniProt Gene Name
Zfand6
UniProt Synonym Gene Names
Awp1; Za20d3
Uniprot Description
Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1 (). Required for PTS1 target sequence-dependent protein import into peroxisomes and PEX5 stability; may cooperate with PEX6. In vitro involved in PEX5 export from the cytosol to peroxisomes.
Research Articles on Zfand6
Similar Products
Product Notes
The Zfand6 zfand6 (Catalog #AAA1474817) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-223, full length protein. The amino acid sequence is listed below: MAQETNHSQA PMLCSTGCGF YGNPRTNGMC SVCYKEHLQR QNSSNGRISP PAASVSSLSE SLPVQCADGS VPDAQSALDS TSSSMQPGPV SNQSLLSESV APSQVDSTSV DKAVSETEDL QGPRAEGLVP LECDPPSSVS DTTQQPSEEQ SKSLEKPKQK KNRCFMCRKK VGLTGFECRC GNVYCGVHRY SDVHNCSYNY KADAAEKIRK ENPVVVGEKI QKI. It is sometimes possible for the material contained within the vial of "AN1-type zinc finger protein 6 (Zfand6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
