Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chymotrypsinogen-B1 Active Protein | CTRB1 active protein

Recombinant Human Chymotrypsinogen-B1

Gene Names
CTRB1; CTRB
Purity
Greater than 95% as determined by HPLC.
Synonyms
Chymotrypsinogen-B1; Recombinant Human Chymotrypsinogen-B1; CTRB1 Human; Human Recombinant; CTRB1 active protein
Ordering
For Research Use Only!
Purity/Purification
Greater than 95% as determined by HPLC.
Form/Format
Sterile filtered lyophilized powder.
The Human CTRB1 was lyophilized without any additives.
Sequence
CG VPAIHPVLSG LSRIVNGEDA VPGSWPWQVS LQDKTGFHFC GGSLISEDWVVTAAHCGVRT SDVVVAGEFD QGSDEENIQV LKIAKVFKNP KFSILTVNND ITLLKLATPA RFSQTVSAVCLPSADDDFPAGTLCATTGWG KTKYNANKTP DKLQQAALPL LSNAECKKSW GRRITDVMIC AGASGVSSCMGDSGGPLVCQ KDGAWTLVGI VSWGSDTCST SSPGVYARVTKLIPWVQKIL AAN
Sequence Length
233
Solubility
It is recommended to reconstitute the lyophilized Human CTRB1 in 1ml 50mM HAc which can then be further diluted to other aqueous solutions.
Biological Activity
1100 units/mg protein. One unit is defined as the amount of enzyme that will hydrolyze 1.0 umole of N-alpha-acetyl-L-tyrosine ethyl ester (ATEE) per min at pH 7.0 at 25 degree C.
Preparation and Storage
Although stable at room temp for 1 week, should be stored desiccated below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for CTRB1 active protein
Description: Recombinant Human CTRB1 expressed in E Coli containing 245 amino acids having a Mw of 27kDa is purified by standard chromatography techniques.
Introduction: Chymotrypsinogen-B1 (CTRB1) belongs to the serine protease family of enzymes and forms a main precursor of the pancreatic proteolytic enzymes. CTRB1 is located next to a related chymotrypsinogen gene. CTRB1 is a protein coding gene which encodes different isoforms which may undergo similar processing to generate the mature protein.
Product Categories/Family for CTRB1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,713 Da
NCBI Official Full Name
chymotrypsinogen B isoform 2
NCBI Official Synonym Full Names
chymotrypsinogen B1
NCBI Official Symbol
CTRB1
NCBI Official Synonym Symbols
CTRB
NCBI Protein Information
chymotrypsinogen B
UniProt Protein Name
Chymotrypsinogen B
Protein Family
UniProt Gene Name
CTRB1

NCBI Description

This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This gene is located adjacent to a related chymotrypsinogen gene. This gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2016]

Uniprot Description

CTRB1: is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin. [provided by RefSeq, Oct 2011]

Protein type: Apoptosis; EC 3.4.21.1; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: extracellular region

Molecular Function: serine-type endopeptidase activity; serine-type peptidase activity

Biological Process: cobalamin metabolic process; extracellular matrix disassembly

Research Articles on CTRB1

Similar Products

Product Notes

The CTRB1 ctrb1 (Catalog #AAA146787) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CG VPAIHPVLSG LSRIVNGEDA VPGSWPWQVS LQDKTGFHFC GGSLISEDWV VTAAHCGVRT SDVVVAGEFD QGSDEENIQV LKIAKVFKNP KFSILTVNND ITLLKLATPA RFSQTVSAVC LPSADDDFPA GTLCATTGWG KTKYNANKTP DKLQQAALPL LSNAECKKSW GRRITDVMIC AGASGVSSCM GDSGGPLVCQ KDGAWTLVGI VSWGSDTCST SSPGVYARVT KLIPWVQKIL AAN. It is sometimes possible for the material contained within the vial of "Chymotrypsinogen-B1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.