Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Teneurin-4 (ODZ4) Recombinant Protein | ODZ4 recombinant protein

Recombinant Human Teneurin-4 (ODZ4) , partial

Gene Names
TENM4; Doc4; ETM5; ODZ4; TNM4; ten-4; Ten-M4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Teneurin-4 (ODZ4); Recombinant Human Teneurin-4 (ODZ4); partial; ODZ4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-345. Partial
Sequence
MDVKERKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLAYGSRVKDIVPQEAEEFCRTGANFTLRELGLEEVTPPHGTLYRTDIGLPHCGYSMGAGSDADMEADTVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHARLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQENWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILGASRHDGAYSDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAALS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
307,957 Da
NCBI Official Full Name
teneurin-4
NCBI Official Synonym Full Names
teneurin transmembrane protein 4
NCBI Official Symbol
TENM4
NCBI Official Synonym Symbols
Doc4; ETM5; ODZ4; TNM4; ten-4; Ten-M4
NCBI Protein Information
teneurin-4
UniProt Protein Name
Teneurin-4
UniProt Gene Name
TENM4
UniProt Synonym Gene Names
KIAA1302; ODZ4; TNM4; Ten-4; Ten-m4

NCBI Description

The protein encoded by this gene plays a role in establishing proper neuronal connectivity during development. Defects in this gene have been associated with hereditary essential tremor-5. [provided by RefSeq, Oct 2016]

Uniprot Description

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Plays a role in the establishment of the anterior-posterior axis during gastrulation. Regulates the differentiation and cellular process formation of oligodendrocytes and myelination of small-diameter axons in the central nervous system (CNS) (PubMed:26188006). Promotes activation of focal adhesion kinase. May function as a cellular signal transducer ().

Research Articles on ODZ4

Similar Products

Product Notes

The ODZ4 tenm4 (Catalog #AAA1465909) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345. Partial. The amino acid sequence is listed below: MDVKERKPYR SLTRRRDAER RYTSSSADSE EGKAPQKSYS SSETLKAYDQ DARLAYGSRV KDIVPQEAEE FCRTGANFTL RELGLEEVTP PHGTLYRTDI GLPHCGYSMG AGSDADMEAD TVLSPEHPVR LWGRSTRSGR SSCLSSRANS NLTLTDTEHE NTETDHPGGL QNHARLRTPP PPLSHAHTPN QHHAASINSL NRGNFTPRSN PSPAPTDHSL SGEPPAGGAQ EPAHAQENWL LNSNIPLETR NLGKQPFLGT LQDNLIEMDI LGASRHDGAY SDGHFLFKPG GTSPLFCTTS PGYPLTSSTV YSPPPRPLPR STFARPAFNL KKPSKYCNWK CAALS . It is sometimes possible for the material contained within the vial of "Teneurin-4 (ODZ4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.