Probable polyamine oxidase 4 (PAO4) Recombinant Protein | PAO4 recombinant protein
Recombinant Arabidopsis thaliana Probable polyamine oxidase 4 (PAO4)
Gene Names
PAO4; ATPAO4; F1E22.18; F1E22_18; polyamine oxidase 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable polyamine oxidase 4 (PAO4); Recombinant Arabidopsis thaliana Probable polyamine oxidase 4 (PAO4); PAO4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497, Full length protein
Sequence
MDKKKNSFPDNLPEGTISELMQKQNNVQPSVIVIGSGISGLAAARNLSEASFKVTVLESRDRIGGRIHTDYSFGCPVDMGASWLHGVSDENPLAPIIRRLGLTLYRTSGDDSILYDHDLESYGLFDMHGNKIPPQLVTKVGDAFKRILEETEKIRDETANDMSVLQGISIVLDRNPELRQEGMAYEVLQWYLCRMEAWFAVDANLISLKCWDQDECLSGGHGLMVQGYEPVIRTIAKDLDIRLNHRVTKVVRTSNNKVIVAVEGGTNFVADAVIITVPIGVLKANLIQFEPELPQWKTSAISGLGVGNENKIALRFDRAFWPNVEFLGMVAPTSYACGYFLNLHKATGHPVLVYMAAGNLAQDLEKLSDEATANFVMLQLKKMFPDAPDPAQYLVTRWGTDPNTLGCYAYDVVGMPEDLYPRLGEPVDNIFFGGEAVNVEHQGSAHGAFLAGVSASQNCQRYIFERLGAWEKLKLVSLMGNSDILETATVPLQISRM
Sequence Length
497
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,931 Da
NCBI Official Full Name
polyamine oxidase 4
NCBI Official Symbol
PAO4
NCBI Official Synonym Symbols
ATPAO4; F1E22.18; F1E22_18; polyamine oxidase 4
NCBI Protein Information
polyamine oxidase 4
UniProt Protein Name
Probable polyamine oxidase 4
Protein Family
UniProt Gene Name
PAO4
UniProt Synonym Gene Names
AtPAO4
NCBI Description
encodes a peroxisomal polyamine oxidase, involved in the back-conversion polyamine degradation pathway. Among the five polyamine oxidases in the Arabidopsis genome, PAO4 is the major isoform in root peroxisomes.
Uniprot Description
Flavoenzyme that catalyzes the oxidation of the secondary amino group of spermine. No activity detected when spermidine, putrescine or N1-acetylspermine are used as substrates.
Research Articles on PAO4
Similar Products
Product Notes
The PAO4 pao4 (Catalog #AAA1464918) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497, Full length protein. The amino acid sequence is listed below: MDKKKNSFPD NLPEGTISEL MQKQNNVQPS VIVIGSGISG LAAARNLSEA SFKVTVLESR DRIGGRIHTD YSFGCPVDMG ASWLHGVSDE NPLAPIIRRL GLTLYRTSGD DSILYDHDLE SYGLFDMHGN KIPPQLVTKV GDAFKRILEE TEKIRDETAN DMSVLQGISI VLDRNPELRQ EGMAYEVLQW YLCRMEAWFA VDANLISLKC WDQDECLSGG HGLMVQGYEP VIRTIAKDLD IRLNHRVTKV VRTSNNKVIV AVEGGTNFVA DAVIITVPIG VLKANLIQFE PELPQWKTSA ISGLGVGNEN KIALRFDRAF WPNVEFLGMV APTSYACGYF LNLHKATGHP VLVYMAAGNL AQDLEKLSDE ATANFVMLQL KKMFPDAPDP AQYLVTRWGT DPNTLGCYAY DVVGMPEDLY PRLGEPVDNI FFGGEAVNVE HQGSAHGAFL AGVSASQNCQ RYIFERLGAW EKLKLVSLMG NSDILETATV PLQISRM. It is sometimes possible for the material contained within the vial of "Probable polyamine oxidase 4 (PAO4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
