Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNA (cytosine-5)-methyltransferase DRM2 (DRM2) Recombinant Protein | DRM2 recombinant protein

Recombinant Arabidopsis thaliana DNA (cytosine-5)-methyltransferase DRM2 (DRM2) , partial

Gene Names
DRM2; AT5G14630; DMT7; domains rearranged methyltransferase 2; NA METHYLTRANSFERASE; T15N1.110; T15N1_110
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA (cytosine-5)-methyltransferase DRM2 (DRM2); Recombinant Arabidopsis thaliana DNA (cytosine-5)-methyltransferase DRM2 (DRM2); partial; DRM2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
291-626. Partial, inclduing the SAM-dependent MTase DRM-type Domain
Sequence
PGLITHRSLPELARGPPFFYYENVALTPKGVWETISRHLFEIPPEFVDSKYFCVAARKRGYIHNLPINNRFQIQPPPKYTIHDAFPLSKRWWPEWDKRTKLNCILTCTGSAQLTNRIRVALEPYNEEPEPPKHVQRYVIDQCKKWNLVWVGKNKAAPLEPDEMESILGFPKNHTRGGGMSRTERFKSLGNSFQVDTVAYHLSVLKPIFPHGINVLSLFTGIGGGEVALHRLQIKMKLVVSVEISKVNRNILKDFWEQTNQTGELIEFSDIQHLTNDTIEGLMEKYGGFDLVIGGSPCNNLAGGNRVSRVGLEGDQSSLFFEYCRILEVVRARMRGS
Sequence Length
626
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,431 Da
NCBI Official Full Name
domains rearranged methyltransferase 2
NCBI Official Symbol
DRM2
NCBI Official Synonym Symbols
AT5G14630; DMT7; domains rearranged methyltransferase 2; NA METHYLTRANSFERASE; T15N1.110; T15N1_110
NCBI Protein Information
domains rearranged methyltransferase 2
UniProt Protein Name
DNA (cytosine-5)-methyltransferase DRM2
Protein Family
DNA
UniProt Gene Name
DRM2

NCBI Description

A putative DNA methyltransferase with rearranged catalytic domains; similar to mammalian DNMT3 methyltransferases; contains UBA domains. The 3'-end proximal part of the gene coding region is highly methylated at both adenine and cytosine residues.

Uniprot Description

Involved in de novo DNA methylation. Controls asymmetric and CpNpG methylation. Required for FWA gene silencing but not for the maintenance of SUP gene silencing. Functionally redundant to CMT3 to maintain non-CpG methylation. Involved in RNA-directed DNA methylation (RdDM) (PubMed:12121623, PubMed:12151602, PubMed:14680640). Acts as major DNA methyltransferase in the RdDM pathway, and is essential for RNA-directed de novo DNA methylation of cytosines in all sequence contexts (PubMed:21060858, PubMed:21212233). Associates with long non-coding RNA (lncRNA) produced by RNA polymerase V (Pol V). This association is dependent on AGO4 and IDN2, and results in DNA methylation of RdDM target loci (PubMed:24862207).

Research Articles on DRM2

Similar Products

Product Notes

The DRM2 drm2 (Catalog #AAA1463217) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 291-626. Partial, inclduing the SAM-dependent MTase DRM-type Domain. The amino acid sequence is listed below: PGLITHRSLP ELARGPPFFY YENVALTPKG VWETISRHLF EIPPEFVDSK YFCVAARKRG YIHNLPINNR FQIQPPPKYT IHDAFPLSKR WWPEWDKRTK LNCILTCTGS AQLTNRIRVA LEPYNEEPEP PKHVQRYVID QCKKWNLVWV GKNKAAPLEP DEMESILGFP KNHTRGGGMS RTERFKSLGN SFQVDTVAYH LSVLKPIFPH GINVLSLFTG IGGGEVALHR LQIKMKLVVS VEISKVNRNI LKDFWEQTNQ TGELIEFSDI QHLTNDTIEG LMEKYGGFDL VIGGSPCNNL AGGNRVSRVG LEGDQSSLFF EYCRILEVVR ARMRGS . It is sometimes possible for the material contained within the vial of "DNA (cytosine-5)-methyltransferase DRM2 (DRM2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.