PHD finger protein 10 (PHF10) Recombinant Protein | PHF10 recombinant protein

Recombinant Human PHD finger protein 10 (PHF10)

Cat. Num. AAA1461058

• Gene Names: PHF10; BAF45A; XAP135
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: PHD finger protein 10 (PHF10); Recombinant Human PHD finger protein 10 (PHF10); PHF10 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-498, Full length protein
• Sequence: AAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETSSQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
• Sequence Length: 497

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for PHF10 recombinant protein

This gene contains a predicted ORF that encodes a protein with two zinc finger domains. The function of the encoded protein is not known. Sequence analysis suggests that multiple alternatively spliced transcript variants are derived from this gene but the full-length nature of only two of them is known. These two splice variants encode different isoforms. A pseudogene for this gene is located on Xq28.

NCBI and Uniprot Product Information

• NCBI GI #: 194328734
• NCBI GeneID: 55274
• NCBI Accession #: NP_060758.2
• NCBI GenBank Nucleotide #: NM_018288.3
• UniProt Accession #: Q8WUB8; Q2YDA3; Q53HG8; Q9BXD2; Q9NV26
• Molecular Weight: 51,290 Da
• NCBI Official Full Name: PHD finger protein 10 isoform a
• NCBI Official Synonym Full Names: PHD finger protein 10
• NCBI Official Symbol: PHF10
• NCBI Official Synonym Symbols: BAF45A; XAP135
• NCBI Protein Information: PHD finger protein 10
• UniProt Protein Name: PHD finger protein 10
• Protein Family: PHD finger protein
• UniProt Gene Name: PHF10
• UniProt Synonym Gene Names: BAF45A; BAF45a

NCBI Description

This gene contains a predicted ORF that encodes a protein with two zinc finger domains. The function of the encoded protein is not known. Sequence analysis suggests that multiple alternatively spliced transcript variants are derived from this gene but the full-length nature of only two of them is known. These two splice variants encode different isoforms. A pseudogene for this gene is located on Xq28. [provided by RefSeq, Jul 2008]

Uniprot Description

Involved in transcription activity regulation by chromatin remodeling. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth ().