Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SKP1-like protein 1B (SKP1B) Recombinant Protein | SKP1B recombinant protein

Recombinant Arabidopsis thaliana SKP1-like protein 1B (SKP1B)

Gene Names
AT5G42190; Arabidopsis SKP-like 2; ARABIDOPSIS SKP1-LIKE 2; ASK2; MJC20.30; MJC20_30; SKP1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SKP1-like protein 1B (SKP1B); Recombinant Arabidopsis thaliana SKP1-like protein 1B (SKP1B); SKP1B recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-171, Full length protein
Sequence
MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Sequence Length
171
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,097 Da
NCBI Official Full Name
E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein
NCBI Official Symbol
AT5G42190
NCBI Official Synonym Symbols
Arabidopsis SKP-like 2; ARABIDOPSIS SKP1-LIKE 2; ASK2; MJC20.30; MJC20_30; SKP1B
NCBI Protein Information
E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein
UniProt Protein Name
SKP1-like protein 1B
Protein Family
UniProt Gene Name
SKP1B
UniProt Synonym Gene Names
ASK2; UIP2

NCBI Description

Similar to SKP1 in yeast and humans which are involved in mitotic cell cycle control and ubiquitin mediated proteolysis.

Uniprot Description

Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1. SCF(UFO) is required for vegetative and floral organ development as well as for male gametogenesis. SCF(TIR1) is involved in auxin signaling pathway. SCF(COI1) regulates responses to jasmonates. SCF(EID1) and SCF(AFR) are implicated in phytochrome A light signaling. SCF(ADO1), SCF(ADO2), SCF(ADO3) are related to the circadian clock. SCF(ORE9) seems to be involved in senescence. SCF(EBF1/EBF2) may regulate ethylene signaling. Plays a role during embryogenesis and early postembryonic development, especially during cell elongation and division. Contributes to the correct chromosome segregation during tetrad formation.

Research Articles on SKP1B

Similar Products

Product Notes

The SKP1B skp1b (Catalog #AAA1457780) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-171, Full length protein. The amino acid sequence is listed below: MSTVRKITLK SSDGENFEID EAVALESQTI KHMIEDDCTD NGIPLPNVTS KILSKVIEYC KRHVEAAEKS ETTADAAAAT TTTTVASGSS DEDLKTWDSE FIKVDQGTLF DLILAANYLN IKGLLDLTCQ TVADMIKGKT PEEIRKTFNI KNDFTPEEEE EVRRENQWAF E. It is sometimes possible for the material contained within the vial of "SKP1-like protein 1B (SKP1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.