Maternal protein exuperantia-1 (exu1) Recombinant Protein | exu1 recombinant protein
Recombinant Drosophila pseudoobscura pseudoobscura Maternal protein exuperantia-1 (exu1)
Gene Names
Dpseexu1; DpseGA21461; dpse_GLEANR_15659; exu; exu 1; exu1; GA21461
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Maternal protein exuperantia-1 (exu1); Recombinant Drosophila pseudoobscura pseudoobscura Maternal protein exuperantia-1 (exu1); exu1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-495, Full length protein
Sequence
MVAEISKDCVTIAAADQCVDMKEELPAGNYILVGVDVDTTGRRLIDEIVQLAAYTPKDNFQQYIMPYMNLNPAARQRHQIRVISIGFYRMLKSMQTYKIIKSKSEVAALMDFLNWLEMLVAKQPSTDGIVMLYHEERKFIPYMVLEALKKYGLIERFNRTVKSFVNTFNMAKASLGDANLKNCGLRKLSLLLAKSNDESANKENEPENVNRNGSSNDKCHKNGMNQEHDFFEGSANVRAKMVYEVALQLTNSDRTSEPESSEELVNLFNAVKPFAKLVSSDIMELQTQNENMGRQNSFRPVFLNYFRTTLYHRVRAVKFRIVLAENGFTLDSLKAIWTEKRKEGLELALTNIDTLKTEEKTELVELLDSFFDPSKATIKPSFKPNGNGPRRRIRANGAASSKNGAMSSRSTSTEFGAGGDKSQTEGLSAPVPDSTTKSPSPGKTGGRPHRKRNNTRNGFGSAKGPKKAETLNIAAPEPPQSPVAVSTPVAIAATN
Sequence Length
495
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,039 Da
NCBI Official Full Name
exuperantia 1, isoform A
NCBI Official Synonym Full Names
exuperantia 1
NCBI Official Symbol
Dpseexu1
NCBI Official Synonym Symbols
DpseGA21461; dpse_GLEANR_15659; exu; exu 1; exu1; GA21461
NCBI Protein Information
GA21461 gene product from transcript GA21461-RB
UniProt Protein Name
Maternal protein exuperantia-1
Protein Family
UniProt Gene Name
exu1
Uniprot Description
Ensures the proper localization of the mRNA of the bicoid gene to the anterior regions of the oocyte thus playing a fundamental role in the establishment of the polarity of the oocyte. May bind the bcd mRNA ().
Similar Products
Product Notes
The exu1 exu1 (Catalog #AAA1453604) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-495, Full length protein. The amino acid sequence is listed below: MVAEISKDCV TIAAADQCVD MKEELPAGNY ILVGVDVDTT GRRLIDEIVQ LAAYTPKDNF QQYIMPYMNL NPAARQRHQI RVISIGFYRM LKSMQTYKII KSKSEVAALM DFLNWLEMLV AKQPSTDGIV MLYHEERKFI PYMVLEALKK YGLIERFNRT VKSFVNTFNM AKASLGDANL KNCGLRKLSL LLAKSNDESA NKENEPENVN RNGSSNDKCH KNGMNQEHDF FEGSANVRAK MVYEVALQLT NSDRTSEPES SEELVNLFNA VKPFAKLVSS DIMELQTQNE NMGRQNSFRP VFLNYFRTTL YHRVRAVKFR IVLAENGFTL DSLKAIWTEK RKEGLELALT NIDTLKTEEK TELVELLDSF FDPSKATIKP SFKPNGNGPR RRIRANGAAS SKNGAMSSRS TSTEFGAGGD KSQTEGLSAP VPDSTTKSPS PGKTGGRPHR KRNNTRNGFG SAKGPKKAET LNIAAPEPPQ SPVAVSTPVA IAATN. It is sometimes possible for the material contained within the vial of "Maternal protein exuperantia-1 (exu1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
