Estradiol 17-beta-dehydrogenase 11 Recombinant Protein | HSD17B11 recombinant protein

Recombinant Human Estradiol 17-beta-dehydrogenase 11

Cat. Num. AAA1451315

• Gene Names: HSD17B11; DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Estradiol 17-beta-dehydrogenase 11; Recombinant Human Estradiol 17-beta-dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-HSD 11; 17bHSD11; 17betaHSD11; 17-beta-hydroxysteroid dehydrogenase XI; 17-beta-HSD XI; 17betaHSDXI; Cutaneous T-cell lymphoma-associated antigen HD-CL-03; CTCL-associated antigen HD-CL-03; Dehydrogenase/reductase SDR family member 8; Retinal short-chain dehydrogenase/reductase 2; retSDR2; Short chain dehydrogenase/reductase family 16C member 2; HSD17B11 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-300aa; Full Length
• Sequence: ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
• Sequence Length: 300

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for HSD17B11 recombinant protein

Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma.

Product Categories/Family for HSD17B11 recombinant protein

Metabolism

References

Short-chain dehydrogenases/reductases in retina.Haeseleer F., Palczewski K.Methods Enzymol. 316:372-383(2000) SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.Hartmann T.B., Thiel D., Dummer R., Schadendorf D., Eichmueller S.Br. J. Dermatol. 150:252-258(2004) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y., Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126(2005) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Cloning and expression of a novel tissue specific 17beta-hydroxysteroid dehydrogenase.Li K.X.Z., Smith R.E., Krozowski Z.S.Endocr. Res. 24:663-667(1998) Pan1b (17betaHSD11) -enzymatic activity and distribution in the lung.Brereton P., Suzuki T., Sasano H., Li K., Duarte C., Obeyesekere V., Haeseleer F., Palczewski K., Smith I., Komesaroff P., Krozowski Z.Mol. Cell. Endocrinol. 171:111-117(2001) 17 beta-hydroxysteroid dehydrogenase type XI localizes to human steroidogenic cells.Chai Z., Brereton P., Suzuki T., Sasano H., Obeyesekere V., Escher G., Saffery R., Fuller P., Enriquez C., Krozowski Z.Endocrinology 144:2084-2091(2003) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.Lukacik P., Bunkoczi G., Kavanagh K., Ng S., Von delft F., Bray J., Edwards A., Arrowsmith C., Sundstrom M., Oppermann U.Submitted (DEC-2004) to the PDB data bank

NCBI and Uniprot Product Information

• NCBI GI #: 613410229
• NCBI GeneID: 51170
• NCBI Accession #: NP_057329.3
• NCBI GenBank Nucleotide #: NM_016245.4
• UniProt Accession #: Q8NBQ5; Q96HF6; Q9UKU4
• Molecular Weight: 46.8 kDa
• NCBI Official Full Name: estradiol 17-beta-dehydrogenase 11
• NCBI Official Synonym Full Names: hydroxysteroid (17-beta) dehydrogenase 11
• NCBI Official Symbol: HSD17B11
• NCBI Official Synonym Symbols: DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI
• NCBI Protein Information: estradiol 17-beta-dehydrogenase 11
• UniProt Protein Name: Estradiol 17-beta-dehydrogenase 11
• Protein Family: Estradiol 17 beta-dehydrogenase
• UniProt Gene Name: HSD17B11
• UniProt Synonym Gene Names: DHRS8; PAN1B; SDR16C2; 17-beta-HSD 11; 17bHSD11; 17betaHSD11; 17-beta-HSD XI; 17betaHSDXI; CTCL-associated antigen HD-CL-03; retSDR2
• UniProt Entry Name: DHB11_HUMAN

NCBI Description

Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]

Uniprot Description

HSD17B11: Can convert androstan-3-alpha,17-beta-diol (3-alpha- diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor- associated antigen in cutaneous T-cell lymphoma. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: Secreted; Secreted, signal peptide; EC 1.1.1.62; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: cytoplasm; cytosol; extracellular region; intracellular membrane-bound organelle; lipid particle

Molecular Function: estradiol 17-beta-dehydrogenase activity; steroid dehydrogenase activity

Biological Process: androgen catabolic process; estrogen biosynthetic process; steroid metabolic process