SDS-Page
Lymphocyte antigen 6E Recombinant Protein | LY6E recombinant protein
Recombinant Human Lymphocyte antigen 6E
Gene Names
LY6E; RIGE; SCA2; RIG-E; SCA-2; TSA-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphocyte antigen 6E; Recombinant Human Lymphocyte antigen 6E; LY6E recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-101. Full Length of Mature Protein
Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Product Categories/Family for LY6E recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.5 kDa
NCBI Official Full Name
lymphocyte antigen 6E
NCBI Official Synonym Full Names
lymphocyte antigen 6 complex, locus E
NCBI Official Symbol
LY6E
NCBI Official Synonym Symbols
RIGE; SCA2; RIG-E; SCA-2; TSA-1
NCBI Protein Information
lymphocyte antigen 6E
UniProt Protein Name
Lymphocyte antigen 6E
Protein Family
UniProt Gene Name
LY6E
UniProt Synonym Gene Names
9804; RIGE; SCA2; TSA1; Ly-6E; RIG-E; SCA-2; TSA-1
UniProt Entry Name
LY6E_HUMAN
Uniprot Description
LY6E: Induced by retinoic acid; in promyelocytic leukemia NB4 and in myeloblast HL-60 cell lines. Activated by IFN-alpha in monocytic cell line U-937 and in peripheral blood monocyte cells.
Protein type: Membrane protein, GPI anchor
Chromosomal Location of Human Ortholog: 8q24.3
Cellular Component: integral to plasma membrane
Biological Process: adrenal gland development; cell surface receptor linked signal transduction; epinephrine secretion; in utero embryonic development; norepinephrine metabolic process; organ growth; ventricular cardiac muscle morphogenesis
Research Articles on LY6E
Similar Products
Product Notes
The LY6E ly6e (Catalog #AAA1448995) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-101. Full Length of Mature Protein. The amino acid sequence is listed below: LMCFSCLNQK SNLYCLKPTI CSDQDNYCVT VSASAGIGNL VTFGHSLSKT CSPACPIPEG VNVGVASMGI SCCQSFLCNF S. It is sometimes possible for the material contained within the vial of "Lymphocyte antigen 6E, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
