Mitogen-activated protein kinase 13 (MAPK13) Recombinant Protein | MAPK13 recombinant protein

Recombinant Pan troglodytes Mitogen-activated protein kinase 13 (MAPK13)

Cat. Num. AAA1446692

• Gene Names: MAPK13; SAPK4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitogen-activated protein kinase 13 (MAPK13); Recombinant Pan troglodytes Mitogen-activated protein kinase 13 (MAPK13); MAPK13 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-365, Full length protein
• Sequence: MSLIRKKGFYKQDVNKXXXELXKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMXFMQTDLQKIMXMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDXAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRXGXKL
• Sequence Length: 365

• Species: Pan troglodytes (Chimpanzee)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 589908377
• NCBI GeneID: 462644
• NCBI Accession #: NP_001029261.2
• NCBI GenBank Nucleotide #: NM_001034089.2
• UniProt Accession #: Q9N272
• Molecular Weight: 42,109 Da
• NCBI Official Full Name: mitogen-activated protein kinase 13
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 13
• NCBI Official Symbol: MAPK13
• NCBI Official Synonym Symbols: SAPK4
• NCBI Protein Information: mitogen-activated protein kinase 13
• UniProt Protein Name: Mitogen-activated protein kinase 13
• UniProt Gene Name: MAPK13
• UniProt Synonym Gene Names: SAPK4; MAP kinase 13; MAPK 13

Uniprot Description

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells ().