Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PHD finger protein 10 (Phf10) Recombinant Protein | Phf10 recombinant protein

Recombinant Mouse PHD finger protein 10 (Phf10)

Gene Names
Phf10; AV024533; 1810055P05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
PHD finger protein 10 (Phf10); Recombinant Mouse PHD finger protein 10 (Phf10); Phf10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-497, full length protein
Sequence
MTAAGPGAAPSPGRCDSDPASPGAQSPKDDNEDNSNDGTHPCKRRRMGSGDSSRSCETSSQDLSFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQSTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTDRTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGGGDEKRKNKGTSDSSSGNVSEGDSPPDSQEDTFHGRQKSKDKMATPRKDGSKRSVLSKSAPGYKPKVIPNALCGICLKGKESNKKGKAESLIHCSQCDNSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDVCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Sequence Length
497
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Phf10 recombinant protein
This gene contains a predicted ORF that encodes a protein with two zinc finger domains. The function of the encoded protein is not known. Sequence analysis suggests that multiple alternatively spliced transcript variants are derived from this gene but the full-length nature of only two of them is known. These two splice variants encode different isoforms. A pseudogene for this gene is located on Xq28.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,611 Da
NCBI Official Full Name
PHD finger protein 10 isoform 1
NCBI Official Synonym Full Names
PHD finger protein 10
NCBI Official Symbol
Phf10
NCBI Official Synonym Symbols
AV024533; 1810055P05Rik
NCBI Protein Information
PHD finger protein 10
UniProt Protein Name
PHD finger protein 10
Protein Family
UniProt Gene Name
Phf10
UniProt Synonym Gene Names
Baf45a; BAF45a

Uniprot Description

Involved in transcription activity regulation by chromatin remodeling. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Research Articles on Phf10

Similar Products

Product Notes

The Phf10 phf10 (Catalog #AAA1442603) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-497, full length protein. The amino acid sequence is listed below: MTAAGPGAAP SPGRCDSDPA SPGAQSPKDD NEDNSNDGTH PCKRRRMGSG DSSRSCETSS QDLSFSYYPA ENLIEYKWPP DETGEYYMLQ EQVSEYLGVT SFKRKYPDLE RRDLSHKEKL YLRELNVITE TQCTLGLTAL RSDEVIDLMI KEYPAKHAEY SVILQEKERQ RITDHYKEYS QMQQQSTQKV EASKVPEYIK KAAKKAAEFN SNLNRERMEE RRAYFDLQTH VIQVPQGKYK VLPTDRTKVS SYPVALIPGQ FQEYYKRYSP DELRYLPLNT ALYEPPLDPE LPALDSDGDS DDGEDGGGDE KRKNKGTSDS SSGNVSEGDS PPDSQEDTFH GRQKSKDKMA TPRKDGSKRS VLSKSAPGYK PKVIPNALCG ICLKGKESNK KGKAESLIHC SQCDNSGHPS CLDMTMELVS MIKTYPWQCM ECKTCIICGQ PHHEEEMMFC DVCDRGYHTF CVGLGAIPSG RWICDCCQRA PPTPRKVGRR GKNSKEG. It is sometimes possible for the material contained within the vial of "PHD finger protein 10 (Phf10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.