Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DDB1- and CUL4-associated factor 11 (Dcaf11) Recombinant Protein | Dcaf11 recombinant protein

Recombinant Mouse DDB1- and CUL4-associated factor 11 (Dcaf11)

Gene Names
Dcaf11; GLO14; Wdr23; C76035; Dacf11; D14Ucla1; 0710008A13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DDB1- and CUL4-associated factor 11 (Dcaf11); Recombinant Mouse DDB1- and CUL4-associated factor 11 (Dcaf11); Dcaf11 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-549, Full length protein
Sequence
MGSRNSSSAGSGSLEPSEGLSRRGTGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGRGAANLQLIQALSDSEEEHDSAWDGRLGDRYNPPVDATPDTRELEYNEIKTQVGLATGRLGLRRTALQQSFPQMLHQRERGLCHRGSFSLGEQSRVMSHFLPNDLSFTDTYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFHKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRRFSSREGMEASRLAATQQNWDYRWQQVPKIAWKKLKLPGDSSLMTYRGHGVLHTLIRCRFSPAHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESDMNRVCSSGPTPVPCPSVAFSSPQ
Sequence Length
549
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,456 Da
NCBI Official Full Name
DDB1- and CUL4-associated factor 11
NCBI Official Synonym Full Names
DDB1 and CUL4 associated factor 11
NCBI Official Symbol
Dcaf11
NCBI Official Synonym Symbols
GLO14; Wdr23; C76035; Dacf11; D14Ucla1; 0710008A13Rik
NCBI Protein Information
DDB1- and CUL4-associated factor 11
UniProt Protein Name
DDB1- and CUL4-associated factor 11
UniProt Gene Name
Dcaf11
UniProt Synonym Gene Names
D14Ucla1; Wdr23

Uniprot Description

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.

Similar Products

Product Notes

The Dcaf11 dcaf11 (Catalog #AAA1436613) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-549, Full length protein. The amino acid sequence is listed below: MGSRNSSSAG SGSLEPSEGL SRRGTGLRRS EEEEEEDEDV DLAQVLAYLL RRGQVRLVQG RGAANLQLIQ ALSDSEEEHD SAWDGRLGDR YNPPVDATPD TRELEYNEIK TQVGLATGRL GLRRTALQQS FPQMLHQRER GLCHRGSFSL GEQSRVMSHF LPNDLSFTDT YSQKAFCGIY SKDGQIFMSA CQDQTIRLYD CRYGRFHKFK SIKARDVGWS VLDVAFTPDG NHFLYSSWSD YIHICNIYGE GDTHTALDLR PDERRFAVFS IAVSSDGREV LGGANDGCLY VFDREQNRRT LQIESHEDDV NAVAFADISS QILFSGGDDA ICKVWDRRTM REDDPKPVGA LAGHQDGITF IDSKGDARYL ISNSKDQTIK LWDIRRFSSR EGMEASRLAA TQQNWDYRWQ QVPKIAWKKL KLPGDSSLMT YRGHGVLHTL IRCRFSPAHS TGQQFIYSGC STGKVVVYDL LSGHIVKKLT NHKACVRDVS WHPFEEKIVS SSWDGNLRLW QYRQAEYFQD DMPESDMNRV CSSGPTPVPC PSVAFSSPQ. It is sometimes possible for the material contained within the vial of "DDB1- and CUL4-associated factor 11 (Dcaf11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.