Homologous-pairing protein 2 homolog (HOP2) Recombinant Protein | HOP2 recombinant protein
Recombinant Arabidopsis thaliana Homologous-pairing protein 2 homolog (HOP2)
Gene Names
AHP2; Arabidopsis Hop2 homolog; HOMOLOGOUS-PAIRING PROTEIN 2; HOP2; T6J4.9; T6J4_9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Homologous-pairing protein 2 homolog (HOP2); Recombinant Arabidopsis thaliana Homologous-pairing protein 2 homolog (HOP2); HOP2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-226, Full length protein
Sequence
MAPKSDNTEAIVLNFVNEQNKPLNTQNAADALQKFNLKKTAVQKALDSLADAGKITFKEYGKQKIYIARQDQFEIPNSEELAQMKEDNAKLQEQLQEKKKTISDVESEIKSLQSNLTLEEIQEKDAKLRKEVKEMEEKLVKLREGITLVRPEDKKAVEDMYADKINQWRKRKRMFRDIWDTVTENSPKDVKELKEELGIEYDEDVGLSFQAYADLIQHGKKRPRGQ
Sequence Length
226
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,245 Da
NCBI Official Full Name
Tat-binding protein 1(Tbp-1)-interacting protein (TBPIP)
NCBI Official Symbol
AHP2
NCBI Official Synonym Symbols
Arabidopsis Hop2 homolog; HOMOLOGOUS-PAIRING PROTEIN 2; HOP2; T6J4.9; T6J4_9
NCBI Protein Information
Tat-binding protein 1(Tbp-1)-interacting protein (TBPIP)
UniProt Protein Name
Homologous-pairing protein 2 homolog
Protein Family
UniProt Gene Name
HOP2
UniProt Synonym Gene Names
AHP2; AtAHP2; AtHOP2
NCBI Description
Encodes the Arabidopsis Hop2 homologue. In other species, Hop2 is proposed to be involved in inter-homolog bias in double strand break repair.
Uniprot Description
Involved in bivalent formation and segregation of homologous chromosomes in meiosis.
Similar Products
Product Notes
The HOP2 hop2 (Catalog #AAA1431480) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-226, Full length protein. The amino acid sequence is listed below: MAPKSDNTEA IVLNFVNEQN KPLNTQNAAD ALQKFNLKKT AVQKALDSLA DAGKITFKEY GKQKIYIARQ DQFEIPNSEE LAQMKEDNAK LQEQLQEKKK TISDVESEIK SLQSNLTLEE IQEKDAKLRK EVKEMEEKLV KLREGITLVR PEDKKAVEDM YADKINQWRK RKRMFRDIWD TVTENSPKDV KELKEELGIE YDEDVGLSFQ AYADLIQHGK KRPRGQ. It is sometimes possible for the material contained within the vial of "Homologous-pairing protein 2 homolog (HOP2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
