Limbic system-associated membrane protein (LSAMP) Recombinant Protein | LSAMP recombinant protein

Recombinant Human Limbic system-associated membrane protein (LSAMP)

Cat. Num. AAA1430780

• Gene Names: LSAMP; LAMP; IGLON3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Limbic system-associated membrane protein (LSAMP); Recombinant Human Limbic system-associated membrane protein (LSAMP); LSAMP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 29-315, Full length protein
• Sequence: VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
• Sequence Length: 287

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for LSAMP recombinant protein

This protein is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

NCBI and Uniprot Product Information

• NCBI GI #: 974576775
• NCBI GeneID: 4045
• NCBI Accession #: NP_001305844.1
• NCBI GenBank Nucleotide #: NM_001318915.1
• UniProt Accession #: Q13449; Q8IV49
• Molecular Weight: 37,393 Da
• NCBI Official Full Name: limbic system-associated membrane protein isoform 2
• NCBI Official Synonym Full Names: limbic system associated membrane protein
• NCBI Official Symbol: LSAMP
• NCBI Official Synonym Symbols: LAMP; IGLON3
• NCBI Protein Information: limbic system-associated membrane protein
• UniProt Protein Name: Limbic system-associated membrane protein
• UniProt Gene Name: LSAMP
• UniProt Synonym Gene Names: IGLON3; LAMP; LSAMP

NCBI Description

This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection ().