Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Endoplasmic oxidoreductin-2 (AERO2) Recombinant Protein | AERO2 recombinant protein

Recombinant Arabidopsis thaliana Endoplasmic oxidoreductin-2 (AERO2)

Gene Names
ERO2; AERO2; endoplasmic reticulum oxidoreductins 2; T7F6.13; T7F6_13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoplasmic oxidoreductin-2 (AERO2); Recombinant Arabidopsis thaliana Endoplasmic oxidoreductin-2 (AERO2); AERO2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-472, Full length protein
Sequence
VFLNTQNSSISEFTGKICNCRQAEQQKYIGIVEDCCCDYETVNRLNTEVLNPLLQDLVKTPFYRYFKVKLWCDCPFWPDDGMCRLRDCSVCECPESEFPEVFKKPLSQYNPVCQEGKPQATVDRTLDTRAFRGWTVTDNPWTSDDETDNDEMTYVNLRLNPERYTGYIGPSARRIWEAIYSENCPKHTSEGSCQEEKILYKLVSGLHSSISVHIASDYLLDEATNLWGQNLTLLYDRVLRYPDRVQNLYFTFLFVLRAVTKAEDYLGEAEYETGNVIEDLKTKSLVKQVVSDPKTKAACPVPFDEAKLWKGQRGPELKQQLEKQFRNISAIMDCVGCEKCRLWGKLQILGLGTALKILFTVNGEDNLRHNLELQRNEVIALMNLLHRLSESVKYVHDMSPAAERIAGGHASSGNSFWQRIVTSIAQSKAVSGKRS
Sequence Length
435
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,449 Da
NCBI Official Full Name
endoplasmic reticulum oxidoreductins 2
NCBI Official Symbol
ERO2
NCBI Official Synonym Symbols
AERO2; endoplasmic reticulum oxidoreductins 2; T7F6.13; T7F6_13
NCBI Protein Information
endoplasmic reticulum oxidoreductins 2
UniProt Protein Name
Endoplasmic reticulum oxidoreductin-2
UniProt Gene Name
AERO2
UniProt Synonym Gene Names
ERO2

NCBI Description

endoplasmic reticulum oxidoreductin

Uniprot Description

Essential oxidoreductase that oxidizes proteins in the endoplasmic reticulum to produce disulfide bonds. Acts by oxidizing directly PDI isomerase through a direct disulfide exchange. Does not act as a direct oxidant of folding substrate, but relies on PDI to transfer oxidizing equivalent. Does not oxidize all PDI related proteins, suggesting that it can discriminate between PDI and related proteins. Its reoxidation probably involves electron transfer to molecular oxygen via FAD. Acts independently of glutathione. May be responsible for a significant proportion of reactive oxygen species (ROS) in the cell, thereby being a source of oxidative stress ().

Similar Products

Product Notes

The AERO2 aero2 (Catalog #AAA1428139) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-472, Full length protein. The amino acid sequence is listed below: VFLNTQNSSI SEFTGKICNC RQAEQQKYIG IVEDCCCDYE TVNRLNTEVL NPLLQDLVKT PFYRYFKVKL WCDCPFWPDD GMCRLRDCSV CECPESEFPE VFKKPLSQYN PVCQEGKPQA TVDRTLDTRA FRGWTVTDNP WTSDDETDND EMTYVNLRLN PERYTGYIGP SARRIWEAIY SENCPKHTSE GSCQEEKILY KLVSGLHSSI SVHIASDYLL DEATNLWGQN LTLLYDRVLR YPDRVQNLYF TFLFVLRAVT KAEDYLGEAE YETGNVIEDL KTKSLVKQVV SDPKTKAACP VPFDEAKLWK GQRGPELKQQ LEKQFRNISA IMDCVGCEKC RLWGKLQILG LGTALKILFT VNGEDNLRHN LELQRNEVIA LMNLLHRLSE SVKYVHDMSP AAERIAGGHA SSGNSFWQRI VTSIAQSKAV SGKRS. It is sometimes possible for the material contained within the vial of "Endoplasmic oxidoreductin-2 (AERO2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.