Salt tolerance protein (STO) Recombinant Protein | STO recombinant protein

Recombinant Arabidopsis thaliana Salt tolerance protein (STO)

Cat. Num. AAA1423893

• Gene Names: STO; B-box domain protein 24; BBX24; SALT TOLERANCE; T21E18.9; T21E18_9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Salt tolerance protein (STO); Recombinant Arabidopsis thaliana Salt tolerance protein (STO); STO recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-248, Full length protein
• Sequence: MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKPMKSNVSHKKPRFETRYDDDDEEHFIVPDLG
• Sequence Length: 248

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 15221367
• NCBI GeneID: 837113
• NCBI Accession #: NP_172094.1
• NCBI GenBank Nucleotide #: NM_100484.4
• UniProt Accession #: Q96288
• Molecular Weight: 27,641 Da
• NCBI Official Full Name: B-box zinc finger family protein
• NCBI Official Symbol: STO
• NCBI Official Synonym Symbols: B-box domain protein 24; BBX24; SALT TOLERANCE; T21E18.9; T21E18_9
• NCBI Protein Information: B-box zinc finger family protein
• UniProt Protein Name: B-box zinc finger protein 24
• Protein Family: Heat-stable enterotoxin
• UniProt Gene Name: BBX24

NCBI Description

Encodes salt tolerance protein (STO) which confers salt tolerance to yeast cells. Fully complements calcineurin deficient yeast but does not encode a phosphoprotein phosphatase. Sequence has similarities to CONSTANS. STO co-localizes with COP1 and plays a role in light signaling.

Uniprot Description

Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688).