Interleukin-13 Active Protein | IL 13 active protein

Recombinant Human Interleukin-13

Cat. Num. AAA142322

• Gene Names: IL13; P600; IL-13
• Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: Interleukin-13; Recombinant Human Interleukin-13; IL 13 Human; Interleukin-13 Human Recombinant; NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789; IL 13 active protein

• Host: E Coli
• Purity/Purification: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
• Sequence Length: 146

• Solubility: It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Protein Content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard.
• Biological Activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106units/mg.
• Preparation and Storage: Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL13 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for IL 13 active protein

Description: Interleukin-13 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.

Introduction: IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells. IL-13 is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Product Categories/Family for IL 13 active protein

Cytokines and Growth Factors; Cytokines; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 26787978
• NCBI GeneID: 3596
• NCBI Accession #: NP_002179.2
• NCBI GenBank Nucleotide #: NM_002188.2
• UniProt Accession #: P35225; O43644; Q4VB52; Q9UDC7
• Molecular Weight: 15,816 Da
• NCBI Official Full Name: interleukin-13
• NCBI Official Synonym Full Names: interleukin 13
• NCBI Official Symbol: IL13
• NCBI Official Synonym Symbols: P600; IL-13
• NCBI Protein Information: interleukin-13
• UniProt Protein Name: Interleukin-13
• Protein Family: Interleukin
• UniProt Gene Name: IL13
• UniProt Synonym Gene Names: NC30; IL-13
• UniProt Entry Name: IL13_HUMAN

NCBI Description

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]

Uniprot Description

IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: protein binding; interleukin-13 receptor binding; cytokine activity

Biological Process: response to nicotine; positive regulation of smooth muscle cell proliferation; microglial cell activation; regulation of proton transport; response to lipopolysaccharide; signal transduction; positive regulation of connective tissue growth factor production; positive regulation of tyrosine phosphorylation of Stat6 protein; positive regulation of immunoglobulin production; response to ethanol; positive regulation of protein secretion; cell-cell signaling; positive regulation of B cell proliferation; immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of NAD(P)H oxidase activity; cell motility; inflammatory response; positive regulation of macrophage activation

Disease: Asthma, Susceptibility To; Allergic Rhinitis