E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1) Recombinant Protein | Nhlrc1 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1)
Gene Names
Nhlrc1; EPM2B; AI505271; B230309E09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1); Recombinant Mouse E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1); Nhlrc1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-401, full length protein
Sequence
MGEEATAVAAAGVRPELVREAEVSLLECKVCFERFGHWQQRRPRNLPCGHVVCLACVAALAHPRTLGLECPFCRRACRACDTSDCLPVLHLLELLGSTLHASPAALSAAPFAPGTLTCYHAFGGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKIFDSGGGGAHQFGEKGDAAHDVKYPLDVAVTNDCHVVVTDAGDCSLKVFDFFGQIKLVVGKQFSLPWGVEITPHNGVLVTDAEAGTLHLLEADFPEGVLRRIERLQAHLCSPRGLAVSWLTGAIAVLEHPCAFGRTGCNNTRVKVFNSTMQLIGQVDSFGLNLLFPSKVTASAVTFDHQGNVIVADTSGPAIVCLGKPEEFPALKPIITHGLSRPVALAFTKENSLLVLDTASHSIKVFKVMEGNGG
Sequence Length
401
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,690 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase NHLRC1
NCBI Official Synonym Full Names
NHL repeat containing 1
NCBI Official Symbol
Nhlrc1
NCBI Official Synonym Symbols
EPM2B; AI505271; B230309E09Rik
NCBI Protein Information
E3 ubiquitin-protein ligase NHLRC1
UniProt Protein Name
E3 ubiquitin-protein ligase NHLRC1
Protein Family
UniProt Gene Name
Nhlrc1
UniProt Synonym Gene Names
Epm2b
Uniprot Description
E3 ubiquitin-protein ligase. Together with the phosphatase EPM2A/laforin, appears to be involved in the clearance of toxic polyglucosan and protein aggregates via multiple pathways. In complex with EPM2A/laforin and HSP70, suppresses the cellular toxicity of misfolded proteins by promoting their degradation through the ubiquitin-proteasome system (UPS). Ubiquitinates the glycogen-targeting protein phosphatase subunits PPP1R3C/PTG and PPP1R3D in a laforin-dependent manner and targets them for proteasome-dependent degradation, thus decreasing glycogen accumulation. Polyubiquitinates EPM2A/laforin and ubiquitinates AGL and targets them for proteasome-dependent degradation. Also promotes proteasome-independent protein degradation through the macroautophagy pathway.
Research Articles on Nhlrc1
Similar Products
Product Notes
The Nhlrc1 nhlrc1 (Catalog #AAA1420923) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-401, full length protein. The amino acid sequence is listed below: MGEEATAVAA AGVRPELVRE AEVSLLECKV CFERFGHWQQ RRPRNLPCGH VVCLACVAAL AHPRTLGLEC PFCRRACRAC DTSDCLPVLH LLELLGSTLH ASPAALSAAP FAPGTLTCYH AFGGWGTLVN PTGLALCPKT GRVVVVHDGK RRVKIFDSGG GGAHQFGEKG DAAHDVKYPL DVAVTNDCHV VVTDAGDCSL KVFDFFGQIK LVVGKQFSLP WGVEITPHNG VLVTDAEAGT LHLLEADFPE GVLRRIERLQ AHLCSPRGLA VSWLTGAIAV LEHPCAFGRT GCNNTRVKVF NSTMQLIGQV DSFGLNLLFP SKVTASAVTF DHQGNVIVAD TSGPAIVCLG KPEEFPALKP IITHGLSRPV ALAFTKENSL LVLDTASHSI KVFKVMEGNG G. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
