Protein lin-7 homolog A (Lin7a) Recombinant Protein | Lin7a recombinant protein

Recombinant Mouse Protein lin-7 homolog A (Lin7a)

Cat. Num. AAA1411979

• Gene Names: Lin7a; Veli; Veli1; LIN-7A; MALS-1; TIP-33; AI848705
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein lin-7 homolog A (Lin7a); Recombinant Mouse Protein lin-7 homolog A (Lin7a); Lin7a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-233, full length protein
• Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQPQQNHMS
• Sequence Length: 233

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 86991442
• NCBI GeneID: 108030
• NCBI Accession #: NP_001034443.1
• NCBI GenBank Nucleotide #: NM_001039354.1
• UniProt Accession #: Q8JZS0
• Molecular Weight: 25,993 Da
• NCBI Official Full Name: protein lin-7 homolog A isoform 1
• NCBI Official Synonym Full Names: lin-7 homolog A (C. elegans)
• NCBI Official Symbol: Lin7a
• NCBI Official Synonym Symbols: Veli; Veli1; LIN-7A; MALS-1; TIP-33; AI848705
• NCBI Protein Information: protein lin-7 homolog A
• UniProt Protein Name: Protein lin-7 homolog A
• Protein Family: Protein
• UniProt Gene Name: Lin7a
• UniProt Synonym Gene Names: Mals1; Veli1; Lin-7A; mLin-7; MALS-1; Veli-1

Uniprot Description

Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.