Protein drumstick (drm) Recombinant Protein | drm recombinant protein
Recombinant Drosophila melanogaster Protein drumstick (drm)
Gene Names
drm; CG10016; DmelCG10016; drum
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein drumstick (drm); Recombinant Drosophila melanogaster Protein drumstick (drm); drm recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-81, Full length protein
Sequence
MFAVMRIDNDDCRSDFRRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRCSQCVWR
Sequence Length
81
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,120 Da
NCBI Official Full Name
drumstick, isoform B
NCBI Official Synonym Full Names
drumstick
NCBI Official Symbol
drm
NCBI Official Synonym Symbols
CG10016; DmelCG10016; drum
NCBI Protein Information
CG10016 gene product from transcript CG10016-RB
UniProt Protein Name
Protein drumstick
Protein Family
UniProt Gene Name
drm
Uniprot Description
Putative transcription factor. May function redundantly with odd and sob in leg joint formation during the larval stages, acting downstream of Notch activation. Acts in a hierarchy during foregut and hindgut patterning and morphogenesis, antagonizing lin to relieve the repressive effect on bowl. Involved in cell rearrangement during elongation of the embryonic hindgut. Regulates expression of hindgut patterning genes to establish the small intestine region of the embryonic hindgut. Required in the foregut for spatially localized gene expression and morphogenesis of the proventriculus.
Research Articles on drm
Similar Products
Product Notes
The drm drm (Catalog #AAA1410670) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-81, Full length protein. The amino acid sequence is listed below: MFAVMRIDND DCRSDFRRKM RPKCEFICKY CQRRFTKPYN LMIHERTHKS PEITYSCEVC GKYFKQRDNL RQHRCSQCVW R. It is sometimes possible for the material contained within the vial of "Protein drumstick (drm), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
