Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

F-box/LRR-repeat protein 7 (FBXL7) Recombinant Protein | FBXL7 recombinant protein

Recombinant Human F-box/LRR-repeat protein 7 (FBXL7)

Gene Names
FBXL7; FBL6; FBL7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
F-box/LRR-repeat protein 7 (FBXL7); Recombinant Human F-box/LRR-repeat protein 7 (FBXL7); FBXL7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-491, Full length protein
Sequence
MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF
Sequence Length
491
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FBXL7 recombinant protein
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. This protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,844 Da
NCBI Official Full Name
F-box/LRR-repeat protein 7 isoform 2
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 7
NCBI Official Symbol
FBXL7
NCBI Official Synonym Symbols
FBL6; FBL7
NCBI Protein Information
F-box/LRR-repeat protein 7
UniProt Protein Name
F-box/LRR-repeat protein 7
Protein Family
UniProt Gene Name
FBXL7
UniProt Synonym Gene Names
FBL6; FBL7; KIAA0840

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiquitin protein ligases called SCFs (SKP1-Cul1-F-box), which play a role in phosphorylation-dependent ubiquitination of proteins. The F-box proteins are divided into 3 subfamilies based on the other domain in the protein: F-box proteins that also have a WD-40 domain (Fbws subfamily), F-box proteins that also have leucine-rich repeats (Fbls subfamily) and F-box proteins that contain other motifs or lack known protein-interaction domains (Fbxs subfamily). The protein encoded by this gene belongs to the Fbls subfamily. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of AURKA during mitosis, causing mitotic arrest.

Research Articles on FBXL7

Similar Products

Product Notes

The FBXL7 fbxl7 (Catalog #AAA1389463) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-491, Full length protein. The amino acid sequence is listed below: MGANNGKQYG SEGKGSSSIS SDVSSSTDHT PTKAQKNVAT SEDSDLSMRT LSTPSPALIC PPNLPGFQNG RGSSTSSSSI TGETVAMVHS PPPTRLTHPL IRLASRPQKE QASIDRLPDH SMVQIFSFLP TNQLCRCARV CRRWYNLAWD PRLWRTIRLT GETINVDRAL KVLTRRLCQD TPNVCLMLET VTVSGCRRLT DRGLYTIAQC CPELRRLEVS GCYNISNEAV FDVVSLCPNL EHLDVSGCSK VTCISLTREA SIKLSPLHGK QISIRYLDMT DCFVLEDEGL HTIAAHCTQL THLYLRRCVR LTDEGLRYLV IYCASIKELS VSDCRFVSDF GLREIAKLES RLRYLSIAHC GRVTDVGIRY VAKYCSKLRY LNARGCEGIT DHGVEYLAKN CTKLKSLDIG KCPLVSDTGL ECLALNCFNL KRLSLKSCES ITGQGLQIVA ANCFDLQTLN VQDCEVSVEA LRFVKRHCKR CVIEHTNPAF F. It is sometimes possible for the material contained within the vial of "F-box/LRR-repeat protein 7 (FBXL7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.