Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Endothelial protein C receptor (Procr) Recombinant Protein | Procr recombinant protein

Recombinant Mouse Endothelial protein C receptor (Procr), partial

Gene Names
Procr; Ccca; Epcr; Ccd41; AI325044
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endothelial protein C receptor (Procr); Recombinant Mouse Endothelial protein C receptor (Procr); partial; Procr recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-214. Fragment at the N-terminal, provide the complete extracellular domain.
Sequence
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS
Sequence Length
214
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Procr recombinant protein
This protein is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein C. Mutations in this gene have been associated with venous thromboembolism and myocardial infarction, as well as with late fetal loss during pregnancy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,189 Da
NCBI Official Full Name
endothelial protein C receptor
NCBI Official Synonym Full Names
protein C receptor, endothelial
NCBI Official Symbol
Procr
NCBI Official Synonym Symbols
Ccca; Epcr; Ccd41; AI325044
NCBI Protein Information
endothelial protein C receptor
UniProt Protein Name
Endothelial protein C receptor
UniProt Gene Name
Procr
UniProt Synonym Gene Names
Epcr; APC receptor

Uniprot Description

Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.

Research Articles on Procr

Similar Products

Product Notes

The Procr procr (Catalog #AAA1387969) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-214. Fragment at the N-terminal, provide the complete extracellular domain. The amino acid sequence is listed below: LCNSDGSQSL HMLQISYFQD NHHVRHQGNA SLGKLLTHTL EGPSQNVTIL QLQPWQDPES WERTESGLQI YLTQFESLVK LVYRERKENV FFPLTVSCSL GCELPEEEEE GSEPHVFFDV AVNGSAFVSF RPKTAVWVSG SQEPSKAANF TLKQLNAYNR TRYELQEFLQ DTCVEFLENH ITTQNMKGSQ TGRSYTS . It is sometimes possible for the material contained within the vial of "Endothelial protein C receptor (Procr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.