Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Latent-transforming growth factor beta-binding protein 1 (LTBP1) Recombinant Protein | LTBP1 recombinant protein

Recombinant Human Latent-transforming growth factor beta-binding protein 1 (LTBP1) , partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Latent-transforming growth factor beta-binding protein 1 (LTBP1); Recombinant Human Latent-transforming growth factor beta-binding protein 1 (LTBP1); partial; LTBP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-307, Partial
Sequence
SAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNARYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHPNPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKAPGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVVIHHGQTQEY
Sequence Length
307
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
153,006 Da
NCBI Official Full Name
latent-transforming growth factor beta-binding protein 1 isoform LTBP-1S
NCBI Official Synonym Full Names
latent transforming growth factor beta binding protein 1
NCBI Official Symbol
LTBP1
NCBI Protein Information
latent-transforming growth factor beta-binding protein 1
UniProt Protein Name
Latent-transforming growth factor beta-binding protein 1
UniProt Gene Name
LTBP1
UniProt Synonym Gene Names
LTBP-1; TGF-beta1-BP-1

NCBI Description

The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

May be involved in the assembly, secretion and targeting of TGFB1 to sites at which it is stored and/or activated. May play critical roles in controlling and directing the activity of TGFB1. May have a structural role in the extracellular matrix (ECM).

Research Articles on LTBP1

Similar Products

Product Notes

The LTBP1 ltbp1 (Catalog #AAA1387745) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-307, Partial. The amino acid sequence is listed below: SAHGRLRRIT YVVHPGPGLA AGALPLSGPP RSRTFNVALN ARYSRSSAAA GAPSRASPGV PSERTRRTSK PGGAALQGLR PPPPPPPEPA RPAVPGGQLH PNPGGHPAAA PFTKQGRQVV RSKVPQETQS GGGSRLQVHQ KQQLQGVNVC GGRCCHGWSK APGSQRCTKP SCVPPCQNGG MCLRPQLCVC KPGTKGKACE TIAAQDTSSP VFGGQSPGAA SSWGPPEQAA KHTSSKKADT LPRVSPVAQM TLTLKPKPSV GLPQQIHSQV TPLSSQSVVI HHGQTQEY . It is sometimes possible for the material contained within the vial of "Latent-transforming growth factor beta-binding protein 1 (LTBP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.