NifU-like protein 5, mitochondrial (NIFU5) Recombinant Protein | NIFU5 recombinant protein
Recombinant Arabidopsis thaliana NifU-like protein 5, mitochondrial (NIFU5)
Gene Names
NFU5; ATNFU1; F11M15.25; F11M15_25; NFU domain protein 5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NifU-like protein 5; mitochondrial (NIFU5); Recombinant Arabidopsis thaliana NifU-like protein 5; NIFU5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
62-275, Full length protein
Sequence
SSFPFNWIEQRRTMFIQTQSTPNPSSLMFSPGKPVMEIGSADFPNSRSAMSSPLAKAIFAIDGVVRVFYGSDFVTVTKSDDVTWDILKPDIFAVVMDFYSSGQPLFLDSQATAAKDTAIHEDDSETVAMIKELLETRIRPSVQDDGGDIEYCGFDTETGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVEQEFDGEEEGTSSGPME
Sequence Length
214
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,972 Da
NCBI Official Full Name
NFU domain protein 5
NCBI Official Symbol
NFU5
NCBI Official Synonym Symbols
ATNFU1; F11M15.25; F11M15_25; NFU domain protein 5
NCBI Protein Information
NFU domain protein 5
UniProt Protein Name
NifU-like protein 5, mitochondrial
Protein Family
UniProt Gene Name
NIFU5
UniProt Synonym Gene Names
NFU1; NFU5; AtNfu-I; AtNfu5
NCBI Description
Encodes a protein containing the NFU domain that may be involved in iron-sulfur cluster assembly. Part of a five member gene family, more closely related to NFU4 than to NFU1,2, and 3. Targeted to the mitochondrion.
Uniprot Description
Molecular scaffold for [Fe-S] cluster assembly of mitochondrial iron-sulfur proteins.
Similar Products
Product Notes
The NIFU5 nifu5 (Catalog #AAA1387008) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 62-275, Full length protein. The amino acid sequence is listed below: SSFPFNWIEQ RRTMFIQTQS TPNPSSLMFS PGKPVMEIGS ADFPNSRSAM SSPLAKAIFA IDGVVRVFYG SDFVTVTKSD DVTWDILKPD IFAVVMDFYS SGQPLFLDSQ ATAAKDTAIH EDDSETVAMI KELLETRIRP SVQDDGGDIE YCGFDTETGI VKLRMQGACS GCPSSSVTLK SGIENMLMHY VSEVKGVEQE FDGEEEGTSS GPME. It is sometimes possible for the material contained within the vial of "NifU-like protein 5, mitochondrial (NIFU5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
