Cysteine protease ATG4C (ATG4C) Recombinant Protein | ATG4C recombinant protein

Recombinant Human Cysteine protease ATG4C (ATG4C)

Cat. Num. AAA1385545

• Gene Names: ATG4C; APG4C; AUTL1; AUTL3; APG4-C
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cysteine protease ATG4C (ATG4C); Recombinant Human Cysteine protease ATG4C (ATG4C); ATG4C recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-458, Full length protein
• Sequence: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
• Sequence Length: 458

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ATG4C recombinant protein

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.

NCBI and Uniprot Product Information

• NCBI GI #: 30410844
• NCBI GeneID: 84938
• NCBI Accession #: NP_116241.2
• NCBI GenBank Nucleotide #: NM_032852.3
• UniProt Accession #: Q96DT6; Q96K04; A6NLR8; D3DQ58
• Molecular Weight: 52,497 Da
• NCBI Official Full Name: cysteine protease ATG4C
• NCBI Official Synonym Full Names: autophagy related 4C cysteine peptidase
• NCBI Official Symbol: ATG4C
• NCBI Official Synonym Symbols: APG4C; AUTL1; AUTL3; APG4-C
• NCBI Protein Information: cysteine protease ATG4C
• UniProt Protein Name: Cysteine protease ATG4C
• Protein Family: Cysteine protease
• UniProt Gene Name: ATG4C
• UniProt Synonym Gene Names: APG4C; AUTL1; AUTL3

NCBI Description

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Is not essential for autophagy development under normal conditions but is required for a proper autophagic response under stressful conditions such as prolonged starvation (). Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms.