Calcium and integrin-binding protein 1 (Cib1) Recombinant Protein | Cib1 recombinant protein

Recombinant Rat Calcium and integrin-binding protein 1 (Cib1)

Cat. Num. AAA1382230

• Gene Names: Cib1; Cib; Sip2-28
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calcium and integrin-binding protein 1 (Cib1); Recombinant Rat Calcium and integrin-binding protein 1 (Cib1); Cib1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-191, full length protein
• Sequence: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL
• Sequence Length: 190

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cib1 recombinant protein

This protein is a member of the calcium-binding protein family. The specific function of this protein has not yet been determined; however this protein is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining. This protein also interacts with integrin alpha(IIb)beta(3), which may implicate this protein as a regulatory molecule for alpha(IIb)beta(3).

NCBI and Uniprot Product Information

• NCBI GI #: 13592135
• NCBI GeneID: 81823
• NCBI Accession #: NP_112407.1
• NCBI GenBank Nucleotide #: NM_031145.1
• UniProt Accession #: Q9R010; Q5BKA8
• Molecular Weight: 21,800 Da
• NCBI Official Full Name: calcium and integrin-binding protein 1
• NCBI Official Synonym Full Names: calcium and integrin binding 1
• NCBI Official Symbol: Cib1
• NCBI Official Synonym Symbols: Cib; Sip2-28
• NCBI Protein Information: calcium and integrin-binding protein 1
• UniProt Protein Name: Calcium and integrin-binding protein 1
• Protein Family: Calcium and integrin-binding protein
• UniProt Gene Name: Cib1
• UniProt Synonym Gene Names: Cib; Kip; Prkdcip; CIB; KIP

NCBI Description

interacts with both Fnk and Snk kinases [RGD, Feb 2006]

Uniprot Description

Calcium-binding protein that plays a role in the regulation of numerous cellular processes, such as cell differentiation, cell division, cell proliferation, cell migration, thrombosis, angiogenesis, cardiac hypertrophy and apoptosis. Involved in bone marrow megakaryocyte differentiation by negatively regulating thrombopoietin-mediated signaling pathway. Participates in the endomitotic cell cycle of megakaryocyte, a form of mitosis in which both karyokinesis and cytokinesis are interrupted. Plays a role in integrin signaling by negatively regulating alpha-IIb/beta3 activation in thrombin-stimulated megakaryocytes preventing platelet aggregation. Up-regulates PTK2/FAK1 activity, and is also needed for the recruitment of PTK2/FAK1 to focal adhesions; it thus appears to play an important role in focal adhesion formation. Positively regulates cell migration on fibronectin in a CDC42-dependent manner, the effect being negatively regulated by PAK1. Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. Down-regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Involved in sphingosine kinase SPHK1 translocation to the plasma membrane in a N-myristoylation-dependent manner preventing TNF-alpha-induced apoptosis. Regulates serine/threonine-protein kinase PLK3 activity for proper completion of cell division progression. Plays a role in microtubule (MT) dynamics during neuronal development; disrupts the MT depolymerization activity of STMN2 attenuating NGF-induced neurite outgrowth and the MT reorganization at the edge of lamellipodia. Promotes cardiomyocyte hypertrophy via activation of the calcineurin/NFAT signaling pathway. Stimulates calcineurin PPP3R1 activity by mediating its anchoring to the sarcolemma. In ischemia-induced (pathological or adaptive) angiogenesis, stimulates endothelial cell proliferation, migration and microvessel formation by activating the PAK1 and ERK1/ERK2 signaling pathway. Promotes also cancer cell survival and proliferation. May regulate cell cycle and differentiation of spermatogenic germ cells, and/or differentiation of supporting Sertoli cells ().