Coronin-2A (CORO2A) Recombinant Protein | CORO2A recombinant protein
Recombinant Human Coronin-2A (CORO2A)
Gene Names
CORO2A; IR10; WDR2; CLIPINB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coronin-2A (CORO2A); Recombinant Human Coronin-2A (CORO2A); CORO2A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-525, Full length protein
Sequence
MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL
Sequence Length
525
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CORO2A recombinant protein
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,763 Da
NCBI Official Full Name
coronin-2A
NCBI Official Synonym Full Names
coronin 2A
NCBI Official Symbol
CORO2A
NCBI Official Synonym Symbols
IR10; WDR2; CLIPINB
NCBI Protein Information
coronin-2A
UniProt Protein Name
Coronin-2A
Protein Family
UniProt Gene Name
CORO2A
UniProt Synonym Gene Names
IR10; WDR2
NCBI Description
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008]
Research Articles on CORO2A
Similar Products
Product Notes
The CORO2A coro2a (Catalog #AAA1378771) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-525, Full length protein. The amino acid sequence is listed below: MSWHPQYRSS KFRHVFGKPA SKENCYDSVP ITRSVHDNHF CAVNPHFIAV VTECAGGGAF LVIPLHQTGK LDPHYPKVCG HRGNVLDVKW NPFDDFEIAS CSEDATIKIW SIPKQLLTRN LTAYRKELVG HARRVGLVEW HPTAANILFS AGYDYKVMIW NLDTKESVIT SPMSTISCHQ DVILSMSFNT NGSLLATTCK DRKIRVIDPR AGTVLQEASY KGHRASKVLF LGNLKKLMST GTSRWNNRQV ALWDQDNLSV PLMEEDLDGS SGVLFPFYDA DTSMLYVVGK GDGNIRYYEV SADKPHLSYL TEYRSYNPQK GIGVMPKRGL DVSSCEIFRF YKLITTKSLI EPISMIVPRR SESYQEDIYP PTAGAQPSLT AQEWLSGMNR DPILVSLRPG SELLRPHPLP AERPIFNSMA PASPRLLNQT EKLAAEDGWR SSSLLEEKMP RWAAEHRLEE KKTWLTNGFD VFECPPPKTE NELLQMFYRQ QEEIRRLREL LTQREVQAKQ LELEIKNLRM GSEQL. It is sometimes possible for the material contained within the vial of "Coronin-2A (CORO2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
