BTB/POZ and TAZ domain-containing protein 2 (BT2) Recombinant Protein | BT2 recombinant protein

Recombinant Arabidopsis thaliana BTB/POZ and TAZ domain-containing protein 2 (BT2)

Cat. Num. AAA1378268

• Gene Names: BT2; ATBT2; BTB and TAZ domain protein 2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: BTB/POZ and TAZ domain-containing protein 2 (BT2); Recombinant Arabidopsis thaliana BTB/POZ and TAZ domain-containing protein 2 (BT2); BT2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-364, Full length protein
• Sequence: MEAVLVAMSVPATTEDDGFSLITDKLSYNLTPTSDVEIVTSDNRRIPAHSGVLASASPVLMNIMKKPMRRYRGCGSKRVIKILGVPCDAVSVFIKFLYSSSLTEDEMERYGIHLLALSHVYMVTQLKQRCSKGVVQRLTTENVVDVLQLARLCDAPDVCLRSMRLIHSQFKTVEQTEGWKFIQEHDPFLELDILQFIDDAESRKKRRRRHRKEQDLYMQLSEAMECIEHICTQGCTLVGPSNVVDNNKKSMTAEKSEPCKAFSTCYGLQLLIRHFAVCKRRNNDKGCLRCKRMLQLFRLHSLICDQPDSCRVPLCRQFRKRGEQDKKMGEDTKWKLLVTRVVSAKAMTSLCQSKKNKCEQAQGV
• Sequence Length: 364

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 18408618
• NCBI GeneID: 823994
• NCBI Accession #: NP_566902.1
• NCBI GenBank Nucleotide #: NM_114697.4
• UniProt Accession #: Q94BN0; Q9STL6
• Molecular Weight: 41,561 Da
• NCBI Official Full Name: BTB and TAZ domain protein 2
• NCBI Official Symbol: BT2
• NCBI Official Synonym Symbols: ATBT2; BTB and TAZ domain protein 2
• NCBI Protein Information: BTB and TAZ domain protein 2
• UniProt Protein Name: BTB/POZ and TAZ domain-containing protein 2
• Protein Family: BTB/POZ and TAZ domain-containing protein
• UniProt Gene Name: BT2

NCBI Description

encodes a protein (BT2) that is an essential component of the TAC1-mediated telomerase activation pathway. Acts redundantly with BT3 and BT1 during female gametophyte development and with BT3 during male gametophyte development. BT2 also mediates multiple responses to nutrients, stresses, and hormones.

Uniprot Description

May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Plays a key role as a component of the TAC1-mediated telomerase activation pathway certainly by targeting a telomerase repressor to degradation. Seems to occupy an integral position in a complex signaling network that perceives, integrates, and responds to multiple, and sometimes competing, signals. Enhances responses to auxin in postgermination and vegetative development. Also negatively regulates ABA- and sugar-mediated inhibition of the germination. Essential for female and male gametophyte development.