Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C motif chemokine 15 (CCL15) Recombinant Protein | CCL15 recombinant protein

Recombinant Human C-C motif chemokine 15 (CCL15)

Gene Names
CCL15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; SCYL3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; MIP-1 delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 15 (CCL15); Recombinant Human C-C motif chemokine 15 (CCL15); CCL15 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-113, Full length protein
Sequence
QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Sequence Length
92
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CCL15 recombinant protein
This gene, chemokine (C-C motif) ligand 15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene, chemokine (C-C motif) ligand 14, and are represented as GeneID: 348249.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,248 Da
NCBI Official Full Name
C-C motif chemokine 15 preproprotein
NCBI Official Synonym Full Names
C-C motif chemokine ligand 15
NCBI Official Symbol
CCL15
NCBI Official Synonym Symbols
LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; SCYL3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; MIP-1 delta
NCBI Protein Information
C-C motif chemokine 15
UniProt Protein Name
C-C motif chemokine 15
Protein Family
UniProt Gene Name
CCL15
UniProt Synonym Gene Names
MIP5; NCC3; SCYA15; HCC-2; LKN-1; MIP-5

NCBI Description

This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013]

Uniprot Description

Chemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15.

Research Articles on CCL15

Similar Products

Product Notes

The CCL15 ccl15 (Catalog #AAA1377647) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-113, Full length protein. The amino acid sequence is listed below: QFINDAETEL MMSKLPLENP VVLNSFHFAA DCCTSYISQS IPCSLMKSYF ETSSECSKPG VIFLTKKGRQ VCAKPSGPGV QDCMKKLKPY SI. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 15 (CCL15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.