SDS-Page
Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial Recombinant Protein | JMJD1C recombinant protein
Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial
Gene Names
JMJD1C; TRIP8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C); partial; Recombinant Human Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C); Probable JmjC domain-containing histone demethylation protein 2C; EC=1.14.11.-; Jumonji domain-containing protein 1C; Thyroid receptor-interacting protein 8; TR-interacting protein 8; TRIP-8; JMJD1C recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2274-2498aa; Partial
Sequence
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Sequence Length
2498
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for JMJD1C recombinant protein
Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes
Product Categories/Family for JMJD1C recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45.5 kDa
NCBI Official Full Name
probable JmjC domain-containing histone demethylation protein 2C isoform c
NCBI Official Synonym Full Names
jumonji domain containing 1C
NCBI Official Symbol
JMJD1C
NCBI Official Synonym Symbols
TRIP8
NCBI Protein Information
probable JmjC domain-containing histone demethylation protein 2C; TRIP-8; TR-interacting protein 8; jumonji domain-containing protein 1C; thyroid hormone receptor interactor 8; thyroid receptor interacting protein 8; thyroid receptor-interacting protein 8
UniProt Protein Name
Probable JmjC domain-containing histone demethylation protein 2C
UniProt Gene Name
JMJD1C
UniProt Synonym Gene Names
JHDM2C; KIAA1380; TRIP8; TR-interacting protein 8; TRIP-8
UniProt Entry Name
JHD2C_HUMAN
Uniprot Description
TRIP8: Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes. Belongs to the JHDM2 histone demethylase family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 1.14.11.-; Oxidoreductase; Demethylase; Transcription, coactivator/corepressor; Nuclear receptor co-regulator
Chromosomal Location of Human Ortholog: 10q21.3
Cellular Component: nucleoplasm; intracellular
Molecular Function: protein binding; dioxygenase activity; metal ion binding; thyroid hormone receptor binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; chromatin modification; blood coagulation
Research Articles on JMJD1C
Similar Products
Product Notes
The JMJD1C jmjd1c (Catalog #AAA1377579) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2274-2498aa; Partial. The amino acid sequence is listed below: MPARYEDLLK SLPLPEYCNP EGKFNLASHL PGFFVRPDLG PRLCSAYGVV AAKDHDIGTT NLHIEVSDVV NILVYVGIAK GNGILSKAGI LKKFEEEDLD DILRKRLKDS SEIPGALWHI YAGKDVDKIR EFLQKISKEQ GLEVLPEHDP IRDQSWYVNK KLRQRLLEEY GVRTCTLIQF LGDAIVLPAG ALHQVQNFHS CIQVTEDFVS PEHLVESFHL TQELR. It is sometimes possible for the material contained within the vial of "Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
