Putative NOL1/NOP2/Sun domain family member 5B (NSUN5P1) Recombinant Protein | NSUN5P1 recombinant protein

Recombinant Human Putative NOL1/NOP2/Sun domain family member 5B (NSUN5P1)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Putative NOL1/NOP2/Sun domain family member 5B (NSUN5P1); Recombinant Human Putative NOL1/NOP2/Sun domain family member 5B (NSUN5P1); NSUN5P1 recombinant protein

Ordering
Cat. Num. AAA1377348 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-163, Full length protein

Sequence

MATLLAWVGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT

Sequence Length

163

Species

Human

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for NSUN5P1 recombinant protein

This gene shares high sequence similarity with the genes WBSCR20A and WBSCR20C; these three genes are the products of gene duplication during evolution. This protein is smaller than the proteins encoded by WBSCR20A and WBSCR20C. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Multiple transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #

118573083

UniProt Accession #

Q3KNT7; Q52LC6; Q8N728; B3KX24

Molecular Weight

16,485 Da

NCBI Official Full Name

Putative NOL1/NOP2/Sun domain family member 5B

UniProt Protein Name

Putative NOL1/NOP2/Sun domain family member 5B

Protein Family

Putative NOL1/NOP2/Sun domain family

UniProt Gene Name

NSUN5P1

UniProt Synonym Gene Names

NSUN5B; WBSCR20B

Similar Products

NSUN5P1 Antibody

Host: Rabbit

Reactivity: Rat

Apps: Immunohistochemistry, Immunohistochemistry, Immunofluorescence, Immunocytochemistry

NSUN5 Antibody

Host: Rabbit

Reactivity: Human

Apps: Western Blot

Product Notes

The NSUN5P1 nsun5p1 (Catalog #AAA1377348) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-163, Full length protein. The amino acid sequence is listed below: MATLLAWVGV SCCELAEEDF LAVSPLDPRY REVHYVLLDP SCSGSGMPSR QLEDPGAGTP SPVRLHALAG FQQRALCHAL TFPSLQRLVY SMCSLCQEEN EDMVPDALQQ NPGAFRLAPA LPARPHRGLS TFPGAEHCLR ASPKTTLSGG FFVAVIERVE MPT. It is sometimes possible for the material contained within the vial of "Putative NOL1/NOP2/Sun domain family member 5B (NSUN5P1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...