Dual specificity protein phosphatase 18 (DUSP18) Recombinant Protein | DUSP18 recombinant protein

Recombinant Human Dual specificity protein phosphatase 18 (DUSP18)

Cat. Num. AAA1369842

• Gene Names: DUSP18; DSP18; DUSP20; LMWDSP20
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dual specificity protein phosphatase 18 (DUSP18); Recombinant Human Dual specificity protein phosphatase 18 (DUSP18); DUSP18 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-188, Full length protein
• Sequence: MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
• Sequence Length: 188

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 755571545
• NCBI GeneID: 150290
• NCBI Accession #: NP_001291723.1
• NCBI GenBank Nucleotide #: NM_001304794.1
• UniProt Accession #: Q8NEJ0; B3KPA4
• Molecular Weight: 21,066 Da
• NCBI Official Full Name: dual specificity protein phosphatase 18 isoform a
• NCBI Official Synonym Full Names: dual specificity phosphatase 18
• NCBI Official Symbol: DUSP18
• NCBI Official Synonym Symbols: DSP18; DUSP20; LMWDSP20
• NCBI Protein Information: dual specificity protein phosphatase 18
• UniProt Protein Name: Dual specificity protein phosphatase 18
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: DUSP18
• UniProt Synonym Gene Names: LMWDSP20; LMW-DSP20

NCBI Description

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]

Uniprot Description

Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP).