Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial (HOGA1) Recombinant Protein | HOGA1 recombinant protein
Recombinant Bovine Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial (HOGA1)
Gene Names
HOGA1; NPL2; DHDPSL; C10orf65
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable 4-hydroxy-2-oxoglutarate aldolase; mitochondrial (HOGA1); Recombinant Bovine Probable 4-hydroxy-2-oxoglutarate aldolase; HOGA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-327, full length protein
Sequence
PSGEGRGMDLSGIYPPVTTPFTATAEVDYGKLEENLHKLGTLPFRGFVVQGSNGEFPFLTSSERLEVVSRARQALPKDKLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSSAALIHHYTKVADLSPVPVVLYSVPANTGLDLPVDAVVTLSQHPNIVGIKDSGGDVTRIGLIVHKTRSQDFQVLAGSAGFLLASYAIGAVGGVCALANVLGSQVCQLERLCLTGQWEDAQKLQHRLIEPNTAVTRRFGIPGLKKTMDWFGYYGGPCRSPLQELSPAQEEALRLDFASNGWL
Sequence Length
302
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,217 Da
NCBI Official Full Name
4-hydroxy-2-oxoglutarate aldolase, mitochondrial
NCBI Official Synonym Full Names
4-hydroxy-2-oxoglutarate aldolase 1
NCBI Official Symbol
HOGA1
NCBI Official Synonym Symbols
NPL2; DHDPSL; C10orf65
NCBI Protein Information
4-hydroxy-2-oxoglutarate aldolase, mitochondrial
UniProt Protein Name
4-hydroxy-2-oxoglutarate aldolase, mitochondrial
Protein Family
UniProt Gene Name
HOGA1
UniProt Synonym Gene Names
DHDPSL; DHDPS-like protein; Probable KHG-aldolase
Uniprot Description
Catalyzes the final step in the metabolic pathway of hydroxyproline.
Research Articles on HOGA1
Similar Products
Product Notes
The HOGA1 hoga1 (Catalog #AAA1368533) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-327, full length protein. The amino acid sequence is listed below: PSGEGRGMDL SGIYPPVTTP FTATAEVDYG KLEENLHKLG TLPFRGFVVQ GSNGEFPFLT SSERLEVVSR ARQALPKDKL LLAGSGCEST QATVEMTVSM AQVGADAAMV VTPCYYRGRM SSAALIHHYT KVADLSPVPV VLYSVPANTG LDLPVDAVVT LSQHPNIVGI KDSGGDVTRI GLIVHKTRSQ DFQVLAGSAG FLLASYAIGA VGGVCALANV LGSQVCQLER LCLTGQWEDA QKLQHRLIEP NTAVTRRFGI PGLKKTMDWF GYYGGPCRSP LQELSPAQEE ALRLDFASNG WL. It is sometimes possible for the material contained within the vial of "Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial (HOGA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
