Structure-specific endonuclease subunit SLX1 (Slx1b) Recombinant Protein | Slx1b recombinant protein
Recombinant Mouse Structure-specific endonuclease subunit SLX1 (Slx1b)
Gene Names
Slx1b; Giyd1; Giyd2; AI853643; 1110030E23Rik; 2410170E21Rik; 4833422P03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Structure-specific endonuclease subunit SLX1 (Slx1b); Recombinant Mouse Structure-specific endonuclease subunit SLX1 (Slx1b); Slx1b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-270, full length protein
Sequence
MDHAARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRHELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQLLPLEGHCPSCKKSLLWGNLVGQCHADTEEEEDLELEEEHWTDLLET
Sequence Length
270
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,099 Da
NCBI Official Full Name
structure-specific endonuclease subunit SLX1
NCBI Official Synonym Full Names
SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae)
NCBI Official Symbol
Slx1b
NCBI Official Synonym Symbols
Giyd1; Giyd2; AI853643; 1110030E23Rik; 2410170E21Rik; 4833422P03Rik
NCBI Protein Information
structure-specific endonuclease subunit SLX1
UniProt Protein Name
Structure-specific endonuclease subunit SLX1
UniProt Gene Name
Slx1b
UniProt Synonym Gene Names
Giyd1; Giyd2; Slx1
Uniprot Description
Catalytic subunit of the SLX1-SLX4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for 5'-flap structures, and promotes symmetrical cleavage of static and migrating Holliday junctions (HJs). Resolves HJs by generating two pairs of ligatable, nicked duplex products.
Research Articles on Slx1b
Similar Products
Product Notes
The Slx1b slx1b (Catalog #AAA1368240) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-270, full length protein. The amino acid sequence is listed below: MDHAARPGRF FGVYLLYCQN PRHRGRVYVG FTVNPARRVR QHNAGRKKGG AWRTSGRGPW DMVLIIHGFP SAVAALRFEW AWQHPQASRR LTHVGPRLRS EAAFAFHLRV LAHMLRVPPW VRLPLTLRWL RPDFRHELCP APPAHMPIAF GPPPPQPLVP KRPAVSEADS ERQLDLGTKA RCSLCARLLQ DEEGPLCCPH PGCPLRAHII CLAEEFLQEE PGQLLPLEGH CPSCKKSLLW GNLVGQCHAD TEEEEDLELE EEHWTDLLET. It is sometimes possible for the material contained within the vial of "Structure-specific endonuclease subunit SLX1 (Slx1b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
