Selenoprotein T (Selt) Recombinant Protein | Selt recombinant protein

Recombinant Rat Selenoprotein T (Selt)

Cat. Num. AAA1366471

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Selenoprotein T (Selt); Recombinant Rat Selenoprotein T (Selt); Selt recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-195, full length protein
• Sequence: SANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
• Sequence Length: 176

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 142976607
• NCBI GeneID: 365802
• NCBI Accession #: NP_001014275.2
• NCBI GenBank Nucleotide #: NM_001014253.3
• UniProt Accession #: Q1H5H1
• Molecular Weight: 22,292 Da
• NCBI Official Full Name: thioredoxin reductase-like selenoprotein T
• NCBI Official Synonym Full Names: selenoprotein T
• NCBI Official Symbol: Selenot
• NCBI Protein Information: thioredoxin reductase-like selenoprotein T
• UniProt Protein Name: Thioredoxin reductase-like selenoprotein T
• Protein Family: Selenoprotein
• UniProt Gene Name: Selenot
• UniProt Synonym Gene Names: SelT

NCBI Description

This gene encodes a selenoprotein, containing a selenocysteine (Sec) residue at the active site. Sec is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is localized in the endoplasmic reticulum. It belongs to the SelWTH family that possesses a thioredoxin-like fold and a conserved CxxU (C is cysteine, U is Sec) motif found in several redox active proteins. Studies in rat indicate a role for this gene in the regulation of calcium homeostasis and smooth muscle contraction. High induction of this gene is also associated with ontogenetic and regenerative processes in nervous, endocrine, and metabolic tissues. A pseudogene of this locus has been identified on chromosome 4. [provided by RefSeq, Aug 2017]

Uniprot Description

Selenoprotein with thioredoxin reductase-like oxidoreductase activity (PubMed:26866473). Protects dopaminergic neurons against oxidative stress ans cell death (). Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion (PubMed:18198219). Plays a role in fibroblast anchorage and redox regulation (). In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation (PubMed:26779623). In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion ().